DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RHOBA (Chaperone protein clpB OS=Rhodopirellula baltica GN=clpB PE=3 SV=2)

HSP 1 Score: 346.665 bits (888), Expect = 1.664e-94
Identity = 169/274 (61.68%), Postives = 217/274 (79.20%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV +V++A++RSR+GL DP+RPI SF+F+GPTGVGKTEL KALA  MF+ E A+VRIDMSE+ME+H+VSRLIGAPPGYVGYEEGG+LTE VRRRPYAVIL DE+EKAH DVFNV LQ+LDDGR+TD QGRTV+FTNTV++MTSNVGSQ I  + +E        + ++Q V DA +  F PEF+NR+D+ ++F PL + QI  IV+LQL+ ++ R+A   +  ++TDAAI  +  +GYDP YGARP+KRVIQ+ V+N LA  IL+  +
Sbjct:  593 VVGQDEAVTAVSDAVRRSRSGLQDPNRPIGSFLFLGPTGVGKTELCKALAEVMFDDESAMVRIDMSEFMERHSVSRLIGAPPGYVGYEEGGKLTEAVRRRPYAVILLDEMEKAHPDVFNVLLQVLDDGRLTDGQGRTVNFTNTVVVMTSNVGSQVIQRVTEE----GGGEDEMRQAVEDALKARFLPEFLNRIDDTVIFHPLQQTQIRRIVQLQLEELRSRLAANGLSFEITDAAIDQIAEVGYDPAYGARPLKRVIQREVQNPLASAILKNSY 862          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_YERPE (Chaperone protein clpB OS=Yersinia pestis GN=clpB PE=3 SV=2)

HSP 1 Score: 345.895 bits (886), Expect = 2.839e-94
Identity = 169/273 (61.90%), Postives = 218/273 (79.85%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD AV++V+ AI+RSRAGLSDP+RPI SF+F+GPTGVGKTEL KALA+++F++++A+VRIDMSE+MEKH+VSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F  +  Y  +K  VMD     FRPEF+NR+DE +VF PL R  ++SI  +QL+R+ KR+ +R  ++++T  A++ LG  G+DP YGARP+KR IQQ +EN LA+ IL G+
Sbjct:  570 VIGQDEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALATFLFDSDDAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLI----QEHF-GQMNYSEMKTVVMDVVSHHFRPEFINRIDEVVVFHPLGRAHLASIANIQLERLYKRLEERGYEVKITQPALEFLGEAGFDPVYGARPLKRAIQQEIENPLAQQILSGK 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_SALTY (Chaperone protein clpB OS=Salmonella typhimurium GN=clpB PE=3 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 2.839e-94
Identity = 170/273 (62.27%), Postives = 218/273 (79.85%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ+ AV++V+ AI+RSRAGLSDP+RPI SF+F+GPTGVGKTEL KALA++MF++++A+VRIDMSE+MEKH+VSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F  E  Y  +K+ V+      FRPEF+NR+DE +VF PL    I+SI ++QL R+ KR+ +R  ++ ++D A++LL + GYDP YGARP+KR IQQ +EN LA+ IL GE
Sbjct:  570 VIGQNEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDDAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLI----QERF-GELDYGRMKEMVLGVVSQNFRPEFINRIDEVVVFHPLGEQHIASIAQIQLQRLYKRLEERGYEIHISDEALKLLSANGYDPVYGARPLKRAIQQQIENPLAQQILSGE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_SALTI (Chaperone protein clpB OS=Salmonella typhi GN=clpB PE=3 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 2.839e-94
Identity = 170/273 (62.27%), Postives = 218/273 (79.85%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ+ AV++V+ AI+RSRAGLSDP+RPI SF+F+GPTGVGKTEL KALA++MF++++A+VRIDMSE+MEKH+VSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I     E F  E  Y  +K+ V+      FRPEF+NR+DE +VF PL    I+SI ++QL R+ KR+ +R  ++ ++D A++LL + GYDP YGARP+KR IQQ +EN LA+ IL GE
Sbjct:  570 VIGQNEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDDAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLI----QERF-GELDYGRMKEMVLGVVSQNFRPEFINRIDEVVVFHPLGEQHIASIAQIQLQRLYKRLEERGYEIHISDEALKLLSANGYDPVYGARPLKRAIQQQIENPLAQQILSGE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PSESM (Chaperone protein clpB OS=Pseudomonas syringae pv. tomato GN=clpB PE=3 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 4.842e-94
Identity = 169/275 (61.45%), Postives = 220/275 (80.00%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            V+GQ+ AV +V+ A++RSRAGLSDP+RP  SFMF+GPTGVGKTEL KALA ++F+TEEA+VRIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAHSDVFN+ LQ+L+DGR+TDS GRTV F NTVI+MTSN+GS  I  +  +        E  +  VMDA    FRPEF+NR+DE ++F+PL RDQI+ I  +QL R++KR+A+R++ M ++  A+  L ++GYDP YGARP+KR IQ+++EN LA+ IL G F+
Sbjct:  570 VIGQEEAVVAVSNAVRRSRAGLSDPNRPSGSFMFLGPTGVGKTELCKALAEFLFDTEEAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHSDVFNILLQVLEDGRLTDSHGRTVDFRNTVIVMTSNLGSAQIQELVGDR-------EAQRAAVMDAVSTHFRPEFVNRIDEVVIFEPLARDQIAGITDIQLGRLRKRLAERELTMVLSPEALDKLIAVGYDPVYGARPLKRAIQRWIENPLAQLILSGGFE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_HAEIN (Chaperone protein clpB OS=Haemophilus influenzae GN=clpB PE=3 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 4.842e-94
Identity = 168/272 (61.76%), Postives = 212/272 (77.94%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ+ AV +VA AI+RSRAGLSDP+RPI SF+F+GPTGVGKTEL K LA ++F++E+A+VRIDMSE+MEKH+VSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH+DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I    DE      +Y  +K  VM      FRPEF+NR+DE +VF PL ++ I +I  +QL+R+ KR+  R  ++  TDA +  +G +GYDP YGARP+KR IQQ +EN LA+ IL G
Sbjct:  570 VIGQEEAVDAVANAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLAKFLFDSEDAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHADVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQGNKDE------SYSEMKALVMSVVSQHFRPEFINRIDETVVFHPLGKENIRAIASIQLERLAKRMETRGYELVFTDALLDFIGEVGYDPIYGARPLKRAIQQEIENSLAQQILSG 835          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB2_THEEB (Chaperone protein clpB 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=clpB2 PE=3 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 4.842e-94
Identity = 168/274 (61.31%), Postives = 223/274 (81.39%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQ  AV +VA AI+R+RAG+ DP RPI SF+FMGPTGVGKTELA+ALA  +F+ E ALVRIDMSEYMEKHAVSR+IGAPPGYVG++ GGQLTE +RRRPYAV+LFDE+EKAH +VFNV LQ+LDDGR+TDSQGRTV F NTVIIMTSN+GS++IL++  +    ++ YE ++QRV+ +A+  FRPEF+NR+D+ I+F  L R +++ I ++QL RV+K +AD+K+ +++T AA+  L ++G+DP YGARP+KR IQ+ +EN LA  +L   F
Sbjct:  584 VIGQSDAVAAVAAAIRRARAGMKDPARPIGSFLFMGPTGVGKTELARALAEALFDDENALVRIDMSEYMEKHAVSRMIGAPPGYVGFDSGGQLTEAIRRRPYAVVLFDEVEKAHPEVFNVLLQVLDDGRITDSQGRTVDFRNTVIIMTSNLGSEHILDLAAD----DSRYEEMRQRVLQSAQKYFRPEFLNRIDDVILFHGLGRTELAQIAQIQLRRVEKLLADQKIHLRLTPAALDHLVAVGFDPVYGARPLKRAIQRELENPLAVKLLEEVF 853          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_AQUAE (Chaperone protein clpB OS=Aquifex aeolicus GN=clpB PE=3 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 6.324e-94
Identity = 171/279 (61.29%), Postives = 224/279 (80.29%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNM----DDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VV Q+ AVK+VAEAI+R+RAGL DP RPIASF+F+GPTGVGKTEL+KALA  +F  E+AL+R+DMSE+ E+H+V++LIGAPPGYVGYEEGG+LTE VRR+PY+VIL DEIEKAH  V ++FLQ+LDDGR+TDS GRTV F NTVIIMTSN+GSQY+LN+    D+ET  +E  +E  K++V++  +L  RPEF+NR+DE IVF+PL   ++S I+ L +  V KR+A+R +K+++T+ A + L   GYDP +GARP+KR IQ+YVE  LA  I+RGE K
Sbjct:  691 VVDQEHAVKAVAEAIRRARAGLKDPKRPIASFLFLGPTGVGKTELSKALAELLFGDEDALIRLDMSEFKEEHSVAKLIGAPPGYVGYEEGGKLTEAVRRKPYSVILLDEIEKAHPRVLDLFLQVLDDGRLTDSHGRTVDFRNTVIIMTSNIGSQYLLNIPVDADEETLNRE--FEKAKEKVLEELKLYMRPEFINRIDEIIVFKPLTMRELSKIIDLLIANVNKRLAERNIKIELTEEAKKELVRRGYDPAFGARPLKRTIQKYVETPLADKIIRGEIK 967          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB1_SYNY3 (Chaperone protein clpB 1 OS=Synechocystis sp. (strain PCC 6803) GN=clpB1 PE=3 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 6.324e-94
Identity = 163/274 (59.49%), Postives = 220/274 (80.29%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQ  AV +V+ AI+R+RAG+ DP RPI SF+FMGPTGVGKTELA+ALA ++F++EEA+VRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQL+E VRRRPY+V+L DE+EKAH DVFN+ LQ+LDDGR+TDSQGR V F NT+I+MTSN+GS +IL++  +    +  Y+ ++++V+ + R  FRPEF+NR+D+ I+F  L RD++  IV LQ+ R++K + ++K+ + ++DAA+  + S GYDP YGARP+KR IQ+ +EN +A  IL   F
Sbjct:  585 VIGQKEAVAAVSAAIRRARAGMKDPSRPIGSFLFMGPTGVGKTELARALAGFLFDSEEAMVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLSEAVRRRPYSVVLLDEVEKAHLDVFNILLQVLDDGRITDSQGRVVDFRNTIIVMTSNIGSDHILSLSAD----DADYDKMQKQVLQSLRKHFRPEFLNRIDDLIIFHTLKRDELRRIVVLQIKRIEKLLDEQKITLSLSDAALDHIVSAGYDPTYGARPLKRAIQRQLENPIATKILENTF 854          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_NEIMB (Chaperone protein clpB OS=Neisseria meningitidis serogroup B GN=clpB PE=3 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 8.259e-94
Identity = 163/274 (59.49%), Postives = 218/274 (79.56%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV++V++AI+RSR+GL+DP++P  SF+F+GPTGVGKTEL KALA ++F++E+ L+RIDMSEYMEKHAV+RLIGAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTVI+MTSN+GSQ+I  M  +       YE +K+ VM+  +  FRPE +NR+DE +VF  LD+D I +I ++QL  ++KR+  + +++ V+DAA+ ++   G+DP YGARP+KR IQ  +EN LAK +L G +
Sbjct:  574 VVGQDEAVRAVSDAIRRSRSGLADPNKPYGSFLFLGPTGVGKTELCKALAGFLFDSEDHLIRIDMSEYMEKHAVARLIGAPPGYVGYEEGGYLTEQVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFKNTVIVMTSNIGSQHIQQMGIQD------YEAVKEVVMEDVKEHFRPEMINRIDEVVVFHGLDQDNIRNIAKIQLKGLEKRLEKQNLRLAVSDAALDIIAKAGFDPIYGARPLKRAIQSEIENPLAKALLAGNY 841          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB_RHOBA1.664e-9461.68Chaperone protein clpB OS=Rhodopirellula baltica G... [more]
CLPB_YERPE2.839e-9461.90Chaperone protein clpB OS=Yersinia pestis GN=clpB ... [more]
CLPB_SALTY2.839e-9462.27Chaperone protein clpB OS=Salmonella typhimurium G... [more]
CLPB_SALTI2.839e-9462.27Chaperone protein clpB OS=Salmonella typhi GN=clpB... [more]
CLPB_PSESM4.842e-9461.45Chaperone protein clpB OS=Pseudomonas syringae pv.... [more]
CLPB_HAEIN4.842e-9461.76Chaperone protein clpB OS=Haemophilus influenzae G... [more]
CLPB2_THEEB4.842e-9461.31Chaperone protein clpB 2 OS=Thermosynechococcus el... [more]
CLPB_AQUAE6.324e-9461.29Chaperone protein clpB OS=Aquifex aeolicus GN=clpB... [more]
CLPB1_SYNY36.324e-9459.49Chaperone protein clpB 1 OS=Synechocystis sp. (str... [more]
CLPB_NEIMB8.259e-9459.49Chaperone protein clpB OS=Neisseria meningitidis s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top