DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_NITEU (Chaperone protein clpB OS=Nitrosomonas europaea GN=clpB PE=3 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 3.470e-92
Identity = 165/274 (60.22%), Postives = 211/274 (77.01%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQD AV+ V++AI+RSR+GL+DP+RP  SF+F+GPTGVGKTEL KALA ++F++EE L+R+DMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE VRR+PY+VIL DE+EKAH DVFNV LQ+LDDGR+TD QGRTV F NTVI+MTSN+GSQ I  M  +       Y+ IK  VM   +  FRPEF+NR+DE +VF  L    I SI R+QL  + KR+A  +MK+ V++ A+  L  +G+DP +GARP+KR IQ  +EN LAK +L G F
Sbjct:  575 VIGQDEAVRLVSDAIRRSRSGLADPNRPYGSFLFLGPTGVGKTELCKALAGFLFDSEEHLIRVDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEQVRRKPYSVILLDEVEKAHPDVFNVLLQVLDDGRMTDGQGRTVDFKNTVIVMTSNLGSQMIQQMSGDD------YQVIKLAVMGEVKTYFRPEFINRIDEVVVFHALGEAHIKSIARIQLSNLGKRLAQMEMKLVVSEPALTKLAEVGFDPVFGARPLKRAIQAQIENPLAKELLEGHF 842          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BACTN (Chaperone protein clpB OS=Bacteroides thetaiotaomicron GN=clpB PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 5.919e-92
Identity = 165/295 (55.93%), Postives = 220/295 (74.58%), Query Frame = 1
Query:    1 KLQQSXXXXXXXXXXXXXXXVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDET--FPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            K+ QS               V+GQD A+++VA+A++RSRAGL DP RPI SF+F+G TGVGKTELAKALA ++F+ E  + RIDMSEY EKH+VSRL+GAPPGYVGY+EGGQLTE +RR+PY+V+LFDEIEKAH DVFN+ LQ+LDDGR+TD++GR V+F NT+IIMTSN+GS YI +  ++     KE   E  K+ VM+  +   RPEF+NR+DE I+F PL   +I  IV LQ+  VQK +A+  +++++TDAA+  L  +GYDP +GARPVKR IQ+Y+ N+L+K +L  E
Sbjct:  548 KMMQSEKDKLLHLEDELHQRVIGQDEAIEAVADAVRRSRAGLQDPKRPIGSFIFLGTTGVGKTELAKALAEFLFDDESMMTRIDMSEYQEKHSVSRLVGAPPGYVGYDEGGQLTEAIRRKPYSVVLFDEIEKAHPDVFNILLQVLDDGRLTDNKGRVVNFKNTIIIMTSNMGSSYIQSQMEKLSGSNKEEVIEETKKEVMNMLKKNIRPEFLNRIDETIMFLPLTETEIRQIVLLQIKGVQKMLAENGVELEMTDAALNFLSQVGYDPEFGARPVKRAIQRYLLNDLSKKLLSQE 842          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_TREDE (Chaperone protein clpB OS=Treponema denticola GN=clpB PE=3 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 7.731e-92
Identity = 167/274 (60.95%), Postives = 213/274 (77.74%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV+ V++AI+R++AGLSD +RP+ SF+ +GPTGVGKTELA+ LA ++FN E+AL RIDMSEYMEKH+VSRLIGAPPGYVGY+EGGQLTE VRRRPY+VILFDEIEKAH DVFNVFLQILDDGR+TD QGR V F NT+IIMTSN+GS+YIL   D          +IK+ +    R  FRPEF+NR+DE + F  L+++ I  IV +QL  V +R+  R++ ++V+D A   L  +GYDP +GARP+KR IQ  +EN+LA+ +L G+F
Sbjct:  574 VVGQDEAVRVVSDAIRRNKAGLSDMNRPLGSFLCIGPTGVGKTELARTLADFLFNDEKALTRIDMSEYMEKHSVSRLIGAPPGYVGYDEGGQLTEAVRRRPYSVILFDEIEKAHQDVFNVFLQILDDGRLTDGQGRVVDFKNTIIIMTSNIGSEYILTAKD--------MGSIKEEINQILRDNFRPEFLNRIDEILTFNRLEKEHIRKIVDIQLRSVAERLQARRLGLKVSDKAKDFLADIGYDPMFGARPLKRAIQAELENKLAREVLEGKF 839          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PHOPR (Chaperone protein clpB OS=Photobacterium profundum GN=clpB PE=3 SV=2)

HSP 1 Score: 337.806 bits (865), Expect = 7.731e-92
Identity = 165/275 (60.00%), Postives = 214/275 (77.82%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            V+GQ+ AV++VA AI+RSRAGLSDP+RPI SF+F+GPTGVGKTEL K LA++MF++E+ +VRIDMSE+MEKH+V+RL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTVIIMTSN+GS  I     E F     YE IK  V++     FRPEF+NRVDE +VF PL ++ I  I  +Q++R+  R+ ++  ++ V ++A+  +   G+DP YGARP+KR IQQY+EN LA+ IL G+ +
Sbjct:  570 VIGQNEAVEAVANAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLANFMFDSEDNMVRIDMSEFMEKHSVARLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGSDRI----QENF-GNLNYEGIKNMVLEVVSQYFRPEFINRVDETVVFHPLGQENIKHIASIQIERLVNRLKEKDYELTVQESALDFVAKAGFDPVYGARPLKRAIQQYIENPLAQEILSGKLE 839          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_AGRT5 (Chaperone protein clpB OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=clpB PE=3 SV=2)

HSP 1 Score: 337.421 bits (864), Expect = 1.010e-91
Identity = 165/273 (60.44%), Postives = 217/273 (79.49%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQ  AV++V++A++RSRAGL DP+RPI SF+F+GPTGVGKTEL K+LA ++F+ E A+VR+DMSEYMEKH+V+RLIGAPPGYVGYEEGG LTE VRRRPY V+LFDEIEKAH DVFNV LQ+LDDGR+TD QGRTV F NT+IIMTSN+GS+++  M D         +++++ VM+  R  FRPEF+NR+D+ I+F  L RD++ +IV +QL R+   +ADRK+ +++ + A   L + GYDP YGARP+KRVIQ+ V++ LA+ IL GE
Sbjct:  572 VVGQGEAVQAVSKAVRRSRAGLQDPNRPIGSFIFLGPTGVGKTELTKSLARFLFDDETAMVRLDMSEYMEKHSVARLIGAPPGYVGYEEGGALTEAVRRRPYQVVLFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFKNTIIIMTSNLGSEFMTQMGD-----NDDVDSVRELVMERVRSHFRPEFLNRIDDIILFHRLRRDEMGAIVEIQLKRLVSLLADRKITLELDEDARSWLANKGYDPAYGARPLKRVIQKSVQDRLAEMILGGE 839          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RALSO (Chaperone protein clpB OS=Ralstonia solanacearum GN=clpB PE=3 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 1.319e-91
Identity = 164/274 (59.85%), Postives = 211/274 (77.01%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV+ V++AI+RSRAG++D ++P  SF+F+GPTGVGKTEL KALA ++F++EE L+RIDMSE+MEKH+VSRLIGAPPGYVGYEEGG LTE VRR+PY+V+L DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTVI+MTSN+GSQ I  M  E      + + IK  V    +  FRPEF+NR+DE +VF  LD+  I SI R+QL R+  R+A   + ++++D A+  L S GYDP +GARP+KR IQQ +EN +A+ IL G F
Sbjct:  573 VVGQDEAVRLVSDAIRRSRAGIADENKPYGSFLFLGPTGVGKTELCKALAGFLFDSEEHLIRIDMSEFMEKHSVSRLIGAPPGYVGYEEGGYLTEAVRRKPYSVVLLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFKNTVIVMTSNLGSQLIQQMASE------SPDVIKGAVWQEVKTHFRPEFLNRIDEVVVFHALDQGHIESIARIQLQRLAARLAHMDLTLEISDPAVAKLASAGYDPVFGARPLKRAIQQQIENPVARMILEGRF 840          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PASMU (Chaperone protein clpB OS=Pasteurella multocida GN=clpB PE=3 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 5.011e-91
Identity = 164/273 (60.07%), Postives = 210/273 (76.92%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ  A+++V+ AI+RSRAGLSDP+RPI SF+F+GPTGVGKTEL K LA+++F+ E A+VRIDMSE+MEKH+VSRL+GAPPGYVGYEEGG LTE VRRRPY+VIL DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+GS  I   ++ T      Y ++K+ VM      FRPEF+NR+DE +VF PL ++ I  I  +QL R+ KR+     ++  TDA +  +G +GYDP YGARP+KR IQQ +EN LA+ IL G+
Sbjct:  569 VIGQHEAIEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLANFLFDDENAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHHDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSHLI--QENSTLD----YPSMKELVMSVVGQHFRPEFINRIDETVVFHPLGKENIREIATIQLARLIKRMESHGYQLHFTDACLDFIGEVGYDPVYGARPLKRAIQQEIENPLAQQILSGK 835          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_CAUCR (Chaperone protein clpB OS=Caulobacter crescentus GN=clpB PE=3 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 8.547e-91
Identity = 162/275 (58.91%), Postives = 213/275 (77.45%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQD A+++V++A++R+RAGL DP +PI SF+F+GPTGVGKTEL K+LA ++F  E A+ R+DMSEYMEKH+VSRLIGAPPGYVGY+EGG LTE +RRRPY V+LFDEIEKAH DVFNV LQ+LDDGR+TD QGRTV F NT+IIMTSN+G++Y+ + +D         E ++  VM+  R  FRPEF+NR+DE I+F+ L R  +  IVR+QL RV+K +ADR+M + +   A+  L   GYDP YGARP+KRVIQ+ + + +AK +L GE +
Sbjct:  568 VVGQDEALEAVSDAVRRARAGLQDPSKPIGSFLFLGPTGVGKTELTKSLAEFLFADEAAITRMDMSEYMEKHSVSRLIGAPPGYVGYDEGGALTEAIRRRPYQVVLFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTLIIMTSNLGAEYLASQED-----GEDVEAVRPMVMNTVRGHFRPEFLNRIDEIILFKRLSRHNMGDIVRIQLQRVEKLLADRRMALALDAEALNWLADKGYDPVYGARPLKRVIQKELVDPIAKKLLAGEIE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RHILO (Chaperone protein clpB OS=Rhizobium loti GN=clpB PE=3 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 1.116e-90
Identity = 162/273 (59.34%), Postives = 214/273 (78.39%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQ  AV++V++A++R+RAGL DP+RPI SF+F+GPTGVGKTEL KALAS++F+ + A+VRIDMSE+MEKH+V+RLIGAPPGYVGYEEGG LTE VRRRPY V+LFDEIEKAH DVFNV LQ+LDDGR+TD QGRTV F NT+IIMTSN+G++Y++N+ +     +   + ++  VM   R  FRPEF+NRVDE I+F  L R  +  IV +Q  R++  + DRK+ + +   AI+ L + GYDP YGARP+KRV+Q+ +++ LA+ IL GE
Sbjct:  570 VVGQGEAVQAVSKAVRRARAGLQDPNRPIGSFIFLGPTGVGKTELTKALASFLFDDDSAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGALTEAVRRRPYQVVLFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTLIIMTSNLGAEYLVNLGE-----DQDVDAVRDEVMGVVRASFRPEFLNRVDEVILFHRLRRKDMDRIVEIQFKRLESLLVDRKITLSLDHEAIEWLAAKGYDPAYGARPLKRVMQKELQDPLAEKILLGE 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_GEOSL (Chaperone protein clpB OS=Geobacter sulfurreducens GN=clpB PE=3 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 3.248e-90
Identity = 161/275 (58.55%), Postives = 215/275 (78.18%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQD A+  VA AI+R+R+GLSDP+RPI SF+F+GPTGVGKTE AKALA ++FN ++A+VRIDMSEY EKH V+RLIGAPPGYVGYEEGGQLTE VRRRPY+++LFDEIEKAH +VFNV LQ+LDDGR+TD QGRTV F NTVIIMTSN+GSQ+I           + Y  +K  V +  +  F+PEF+NR+DE +++  L  +QI  IV +Q++ +++R+ADR++ ++++D A + L   GYDP YGARP+KR IQ+ +++ LA  +L G+F+
Sbjct:  576 VVGQDEALVLVANAIRRARSGLSDPNRPIGSFLFLGPTGVGKTETAKALAEFLFNDDQAIVRIDMSEYQEKHTVARLIGAPPGYVGYEEGGQLTEAVRRRPYSIVLFDEIEKAHPEVFNVLLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGSQWIQQYG------SSDYARMKAMVTETLKEGFKPEFLNRIDEIVIYHALPLEQIKKIVDIQVECLKQRLADRRIVLELSDKAREYLSREGYDPAYGARPLKRTIQRKIQDPLALALLEGKFQ 844          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB_NITEU3.470e-9260.22Chaperone protein clpB OS=Nitrosomonas europaea GN... [more]
CLPB_BACTN5.919e-9255.93Chaperone protein clpB OS=Bacteroides thetaiotaomi... [more]
CLPB_TREDE7.731e-9260.95Chaperone protein clpB OS=Treponema denticola GN=c... [more]
CLPB_PHOPR7.731e-9260.00Chaperone protein clpB OS=Photobacterium profundum... [more]
CLPB_AGRT51.010e-9160.44Chaperone protein clpB OS=Agrobacterium tumefacien... [more]
CLPB_RALSO1.319e-9159.85Chaperone protein clpB OS=Ralstonia solanacearum G... [more]
CLPB_PASMU5.011e-9160.07Chaperone protein clpB OS=Pasteurella multocida GN... [more]
CLPB_CAUCR8.547e-9158.91Chaperone protein clpB OS=Caulobacter crescentus G... [more]
CLPB_RHILO1.116e-9059.34Chaperone protein clpB OS=Rhizobium loti GN=clpB P... [more]
CLPB_GEOSL3.248e-9058.55Chaperone protein clpB OS=Geobacter sulfurreducens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top