DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BIFLO (Chaperone protein clpB OS=Bifidobacterium longum GN=clpB PE=3 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 5.540e-90
Identity = 156/273 (57.14%), Postives = 220/273 (80.59%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ  A+ +V++A++RSRAG+SDP+RP  SF+F+GPTGVGKTELAKALA ++F+ E+A+VRIDMSEYMEK +VSRLIGA PGYVGYE+GGQLTE VRRRPY+V+LFDE+EKA+ ++F+V LQ+LDDGR+TD QGRTV F NT++IMTSN+GSQ+++N D +   K       K+ VMDA  + F+PEF+NR+D+ ++F PL R+++  IV +Q+  V +R+ DR++ + VTD+A + L + GYDP YGARP++R++Q  V ++LA+ +L G+
Sbjct:  581 VIGQKEAIAAVSDAVRRSRAGISDPNRPTGSFLFLGPTGVGKTELAKALADFLFDDEKAMVRIDMSEYMEKASVSRLIGAAPGYVGYEQGGQLTEAVRRRPYSVVLFDEVEKANPEIFDVLLQVLDDGRLTDGQGRTVDFKNTILIMTSNLGSQFLVNEDMDADAK-------KKAVMDAVHMNFKPEFLNRLDDIVMFHPLTREELGGIVDIQVAGVSQRLTDRRITLDVTDSAREWLANTGYDPAYGARPLRRLVQTEVGDQLARMLLAGK 846          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BDEBA (Chaperone protein clpB OS=Bdellovibrio bacteriovorus GN=clpB PE=3 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 5.540e-90
Identity = 169/276 (61.23%), Postives = 211/276 (76.45%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMD-DETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQD A+  VA+AI+R+RA +SDP+RPI +FMF+GPTGVGKTE  KALA ++F+ E+A+VRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTE VRRRPY+V+L DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSNVGSQ IL+    E   +E   E +++R        FRPEF+NR+DE ++F+ L   QIS IV++QLD V +R+  +K+ +     AI  L   GYDP YGARP+KRVIQ  + N L+K I+ G+ K
Sbjct:  572 VVGQDHALTIVADAIRRARAEISDPNRPIGTFMFLGPTGVGKTETVKALAEFLFDDEQAVVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTESVRRRPYSVVLLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFKNTVLIMTSNVGSQSILDPGMSENQKREAVNEALRER--------FRPEFLNRIDEIVMFKSLGEAQISGIVKVQLDLVAQRLRAKKIGIDFNQEAIDFLAKKGYDPIYGARPLKRVIQTELLNPLSKEIISGKVK 839          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB1_STRAW (Chaperone protein clpB 1 OS=Streptomyces avermitilis GN=clpB1 PE=3 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 5.540e-90
Identity = 154/275 (56.00%), Postives = 218/275 (79.27%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            ++GQ  AV++V++A++R+RAG++DP RP  SF+F+GPTGVGKTELAKALA ++F+ E A+VRIDMSEY EKH V+RL+GAPPGYVGYEEGGQLTE VRRRPY+V+L DE+EKAH +VF++ LQ+LDDGR+TD QGRTV F NT++I+TSN+GSQ++          +T+ E  K++V++  R  F+PEF+NR+D+ +VF  L+R ++  I +LQ+DR+ +R+A R+++++VTDAA+  L   G DP YGARP++R++Q  + + LAK IL GE K
Sbjct:  574 LIGQSEAVQAVSDAVRRTRAGIADPDRPTGSFLFLGPTGVGKTELAKALADFLFDDERAMVRIDMSEYGEKHTVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVVLLDEVEKAHPEVFDILLQVLDDGRLTDGQGRTVDFRNTILILTSNLGSQFLSGHGPA--EPQTSEEEKKRQVLEVVRASFKPEFLNRLDDLVVFSALNRQELERIAKLQIDRLAQRLAQRRLRLEVTDAALAWLAEEGNDPAYGARPLRRLVQTAIGDRLAKEILAGEVK 846          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_CLOPE (Chaperone protein clpB OS=Clostridium perfringens GN=clpB PE=3 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 1.234e-89
Identity = 164/273 (60.07%), Postives = 210/273 (76.92%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD A  +VA A+ R+RAGL D  +PI SF+F+GPTGVGKTELAK LA  +F++E+ +VRIDMSEYMEKHAVSRLIG PPGYVGYEEGGQLTE VRR PY+VILFDEIEKAH DVFN+FLQILDDGR+TD++G+TV F NT+IIMTSN+GS Y+L    E    E   + I++ VM+  +L F+PEF+NRVD+ I+F+PL  + I  I+ + L  V+ R+ +R + ++VTD A ++L   GYDP YGARP+KR I   +E E+AK I+ GE
Sbjct:  577 VIGQDEATTAVANAVIRARAGLKDERKPIGSFIFLGPTGVGKTELAKTLARNLFDSEDNIVRIDMSEYMEKHAVSRLIGPPPGYVGYEEGGQLTEAVRRNPYSVILFDEIEKAHDDVFNLFLQILDDGRLTDNKGKTVDFKNTIIIMTSNIGSGYLL----ENKSGEGIEDDIRENVMNEMKLRFKPEFLNRVDDIIMFRPLSSEGIKKIIDIFLRDVENRLRERNITLEVTDRAKEILAEEGYDPVYGARPLKRYISNVLETEIAKKIIAGE 845          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_DESVH (Chaperone protein clpB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=clpB PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.612e-89
Identity = 163/275 (59.27%), Postives = 211/275 (76.73%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQ+ AV +V+EA+ R+RAGLSDP RPI SF+F+GPTGVGKTEL K LA  +F+TEE +VR+DMSEYMEKHAV+RLIGAPPGYVGY+EGGQLTE VRR+PY+V+LFDE+EKAH DVFN  LQILDDGR+TDS GRTV F NT+IIMTSN+GS Y+L   D           ++++VM+  R  FRPEF+NRVDE ++F+PL   QI+ IV L L R++ R+A+RK+ +++ D A   +    YDP YGARP++R +Q  +E  LA+ ++ GE +
Sbjct:  575 VVGQEEAVDAVSEAVLRARAGLSDPSRPIGSFIFLGPTGVGKTELCKTLAEALFDTEENIVRLDMSEYMEKHAVARLIGAPPGYVGYDEGGQLTEAVRRKPYSVVLFDEVEKAHPDVFNTLLQILDDGRLTDSHGRTVDFRNTIIIMTSNIGSPYML---DGISEGGEFLSGVREKVMEELRRHFRPEFLNRVDETVLFKPLLPAQIARIVELLLGRLRGRLAERKIDIRLGDVARDFIAKAAYDPVYGARPLRRYLQHNIETPLARKLIAGELR 846          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_TREPA (Chaperone protein clpB OS=Treponema pallidum GN=clpB PE=3 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 2.105e-89
Identity = 164/284 (57.75%), Postives = 211/284 (74.30%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYIL-------NMDDETFP--KETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQD AV+ +++AI+R++AGLSD  RP+ SF+ +GPTGVGKTELA+ LA ++FN E AL RIDMSEYMEKHA+SRLIGAPPGYVGY+EGGQLTE VRRRPY+V+LFDE+EKAH DVFN+FLQILDDGR+TD QGR V F NT+IIMTSN+GS++IL       +  D   P  + T  +T+ +++       FRPEF+NR+DE ++F+ L R  I  I  +QL  V +R+  R +K++V DAA   L   GYD  +GARP+KR IQ  +EN LA+ IL G F+
Sbjct:  574 VVGQDEAVRVISDAIRRNKAGLSDTRRPLGSFLCVGPTGVGKTELARTLADFLFNDERALTRIDMSEYMEKHAISRLIGAPPGYVGYDEGGQLTEAVRRRPYSVLLFDEVEKAHQDVFNIFLQILDDGRLTDGQGRVVDFRNTIIIMTSNIGSEHILSARESRTHTSDLPVPETQSTEEQTLPEQIRGLLHTYFRPEFLNRIDEVLIFKRLTRKHIRLITDIQLQMVVERLESRHIKLRVRDAAKAYLAERGYDDTFGARPLKRAIQTELENALAREILSGRFR 857          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_DICNO (Chaperone protein clpB OS=Dichelobacter nodosus GN=clpB PE=3 SV=2)

HSP 1 Score: 329.717 bits (844), Expect = 2.105e-89
Identity = 161/274 (58.76%), Postives = 213/274 (77.74%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQ  AV++VA AI+R+RAGLSDP RPI SF+F+GPTGVGKTEL + LA ++F++EE +VRIDMSE+MEKH+V+RLIGAPPGYVGY++GG LTE VRR+PY+V+LFDE+EKAHSDVFN  LQ+LD+GR+TD QGRTV F +TVIIMTSN+GS  I  +       E +YE +K  VM+     FRPEF+NR+DE IVF  L +  +  I ++QL+R+++R+  R++ + V + AI  L  LGYDP +GARP+KR IQ Y+EN LA+ +L G++
Sbjct:  575 VVGQKTAVEAVANAIRRNRAGLSDPKRPIGSFLFLGPTGVGKTELCRTLAQFLFDSEENMVRIDMSEFMEKHSVARLIGAPPGYVGYDQGGYLTEAVRRKPYSVVLFDEVEKAHSDVFNTLLQVLDEGRLTDGQGRTVDFRHTVIIMTSNLGSDMIQLL------AEKSYEEMKSAVMEIVMAHFRPEFINRIDEAIVFHGLAKTHMYRIAQIQLERLRQRLQTRELLLSVEEDAINQLVELGYDPLFGARPLKRAIQNYIENPLAQALLAGQY 842          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RHOPA (Chaperone protein clpB OS=Rhodopseudomonas palustris GN=clpB PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.591e-89
Identity = 165/275 (60.00%), Postives = 210/275 (76.36%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQ  AV +V+ A++R+RAGL DP+RP+ SFMF+GPTGVGKTEL KALA Y+F+ E A+VRIDMSE+MEKH+V+RLIGAPPGYVGY+EGG LTE VRRRPY VILFDEIEKAH DVFNV LQ+LDDGR+TD QGRTV F NT+I+MTSN+GS+Y++N      P+      ++++VM   R  FRPEF+NRVDE I+F  L + ++  IV +Q  R+ K + DRK+ + +  AA   L   G+DP YGARP+KRVIQ+ V++ LA+ IL G  K
Sbjct:  571 VVGQFEAVHAVSTAVRRARAGLQDPNRPMGSFMFLGPTGVGKTELTKALAEYLFDDETAMVRIDMSEFMEKHSVARLIGAPPGYVGYDEGGVLTEAVRRRPYQVILFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTLIVMTSNLGSEYLVNQ-----PEGEDTGAVREQVMGMVRAHFRPEFLNRVDEIILFHRLQKSEMGRIVDIQFARLTKLLEDRKIVLDLDAAARDWLAEKGWDPAYGARPLKRVIQRSVQDPLAEMILEGSVK 840          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BACC1 (Chaperone protein clpB OS=Bacillus cereus (strain ATCC 10987) GN=clpB PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 4.690e-89
Identity = 163/271 (60.15%), Postives = 216/271 (79.70%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILN-MDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGIL 870
            V+GQ+ AV  V++A+ R+RAG+ DP+RPI SF+F+GPTGVGKTELAK LA  +F++EE ++RIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTE VRR+PY+VIL DEIEKAH +VFN+ LQ+LDDGR+TDSQGRTV F NTVIIMTSN+GS ++L+ ++D+   KE +    ++ VM   R  FRPEF+NRVDE I+F+PL  ++I  IV   +  +Q R+ADR + +++TDAA + +   G+DP YGARP+KR +Q+ VE +LA+ ++
Sbjct:  576 VIGQEEAVSLVSDAVLRARAGIKDPNRPIGSFIFLGPTGVGKTELAKTLAQSLFDSEEQMIRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHPEVFNILLQMLDDGRITDSQGRTVDFKNTVIIMTSNIGSAHLLDGLEDDGSIKEES----RELVMGQLRGHFRPEFLNRVDEIILFKPLTTNEIKGIVDKIVKELQGRLADRHITVELTDAAKEFVVEAGFDPMYGARPLKRYVQRQVETKLARELI 842          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB2_STRAW (Chaperone protein clpB 2 OS=Streptomyces avermitilis GN=clpB2 PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 4.690e-89
Identity = 162/273 (59.34%), Postives = 212/273 (77.66%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD AVK V +AI R+R+G+ DP RPI SF+F+GPTGVGKTELAK LA  +F++EE +VR+DMSEY E+H VSRL+GAPPGYVGYEEGGQLTE VRR+PY+V+LFDEIEKAH+DVFN  LQILDDGR+TD+QGRTV F NTVIIMTSN+GS+++L  D  T   E   +  +  VM   R  FRPEF+NRVD+ ++F+PL   QI  IV LQ D +++R+A+R++ +++TDA  +++   GYDP YGARP++R I   VE  + + +LRG+
Sbjct:  578 VIGQDEAVKLVTDAIIRARSGIRDPRRPIGSFIFLGPTGVGKTELAKTLARTLFDSEENMVRLDMSEYQERHTVSRLMGAPPGYVGYEEGGQLTEAVRRKPYSVVLFDEIEKAHTDVFNTLLQILDDGRITDAQGRTVDFRNTVIIMTSNIGSEHLL--DGATAEGEIKPDA-RALVMGELRGHFRPEFLNRVDDIVLFKPLGERQIERIVELQFDELRQRLAERRITVELTDAGREVIAHQGYDPVYGARPLRRYISHEVETLVGRALLRGD 847          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB_BIFLO5.540e-9057.14Chaperone protein clpB OS=Bifidobacterium longum G... [more]
CLPB_BDEBA5.540e-9061.23Chaperone protein clpB OS=Bdellovibrio bacteriovor... [more]
CLPB1_STRAW5.540e-9056.00Chaperone protein clpB 1 OS=Streptomyces avermitil... [more]
CLPB_CLOPE1.234e-8960.07Chaperone protein clpB OS=Clostridium perfringens ... [more]
CLPB_DESVH1.612e-8959.27Chaperone protein clpB OS=Desulfovibrio vulgaris (... [more]
CLPB_TREPA2.105e-8957.75Chaperone protein clpB OS=Treponema pallidum GN=cl... [more]
CLPB_DICNO2.105e-8958.76Chaperone protein clpB OS=Dichelobacter nodosus GN... [more]
CLPB_RHOPA3.591e-8960.00Chaperone protein clpB OS=Rhodopseudomonas palustr... [more]
CLPB_BACC14.690e-8960.15Chaperone protein clpB OS=Bacillus cereus (strain ... [more]
CLPB2_STRAW4.690e-8959.34Chaperone protein clpB 2 OS=Streptomyces avermitil... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top