DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_STRCO (Chaperone protein clpB OS=Streptomyces coelicolor GN=clpB PE=3 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 6.125e-89
Identity = 152/275 (55.27%), Postives = 216/275 (78.55%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            ++GQ  AV++V++A++RSRAG++DP RP  SF+F+GPTGVGKTELAKALA ++F+ E A+VRIDMSEY EKH+V+RL+GAPPGYVGYEEGGQLTE VRRRPY V+L DE+EKAH +VF++ LQ+LDDGR+TD QGRTV F NT++++TSN+GSQY+++         T     KQ+V++  R  F+PEF+NR+D+ +VF  L ++++S I RLQ++ + +R+A+R++ ++VTD A+  L   G DP YGARP++R++Q  + + LA+ IL GE K
Sbjct:  574 LIGQTQAVRAVSDAVRRSRAGIADPDRPTGSFLFLGPTGVGKTELAKALADFLFDDERAMVRIDMSEYSEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYTVVLLDEVEKAHPEVFDILLQVLDDGRLTDGQGRTVDFRNTILVLTSNLGSQYLVD-------PTTGEAEKKQQVLEVVRSSFKPEFLNRLDDLVVFSALSQEELSRIARLQINGLARRLAERRLTLEVTDEALAWLAEEGNDPAYGARPLRRLVQTAIGDRLAREILSGEIK 841          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RICFE (Chaperone protein clpB OS=Rickettsia felis GN=clpB PE=3 SV=2)

HSP 1 Score: 327.791 bits (839), Expect = 8.000e-89
Identity = 152/273 (55.68%), Postives = 218/273 (79.85%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD A+K V++A++RSRAG+ D +RP+ SF+F+GPTGVGKTEL KALAS++F+   A++RIDMSEYMEKHA+SRLIGAPPGY+GY++GG LTE VRRRPY VILFDE+EKAH D+FN+ LQILD+GR+TDSQG TV F NT+I++TSN+G++ ++N  ++    E  Y+ +K  VM+  + +F+PEF+NR+DE I+F  L+R+ I  IV++QL+ ++K +  + + ++  ++A+  L   GYDP++GARP+KR+IQ+ ++N LAK IL GE
Sbjct:  569 VIGQDEAIKGVSDAVRRSRAGIQDINRPLGSFLFLGPTGVGKTELTKALASFLFDDRNAILRIDMSEYMEKHAISRLIGAPPGYIGYDQGGVLTEAVRRRPYQVILFDEVEKAHPDIFNIMLQILDEGRLTDSQGITVDFKNTIIVLTSNLGAEILVNQKED----EDTYK-VKDEVMEYVKAVFKPEFLNRLDEIILFHRLNRNNIHDIVKIQLESLKKILLAQNILLEFDESALNYLAEKGYDPSFGARPLKRLIQREIQNNLAKMILAGE 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BACCR (Chaperone protein clpB OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=clpB PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 8.000e-89
Identity = 162/273 (59.34%), Postives = 216/273 (79.12%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILN-MDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ+ AV  V++A+ R+RAG+ DP+RPI SF+F+GPTGVGKTELAK LA  +F++EE ++RIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTE VRR+PY+V+L DEIEKAH +VFN+ LQ+LDDGR+TDSQGRTV F NTVIIMTSN+GS ++L+ ++++   KE +    +  VM   R  FRPEF+NRVDE I+F+PL  ++I  IV   +  +Q R+ADR + +++TDAA + +   G+DP YGARP+KR +Q+ VE +LA+ ++ G
Sbjct:  576 VIGQEEAVSLVSDAVLRARAGIKDPNRPIGSFIFLGPTGVGKTELAKTLAQSLFDSEEQMIRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVVLLDEIEKAHPEVFNILLQMLDDGRITDSQGRTVDFKNTVIIMTSNIGSAHLLDGLEEDGSIKEES----RDLVMGQLRGHFRPEFLNRVDEIILFKPLTTNEIKGIVDKIVKELQGRLADRHITVELTDAAKEFVVEAGFDPMYGARPLKRYVQRQVETKLARELIAG 844          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_HAEDU (Chaperone protein clpB OS=Haemophilus ducreyi GN=clpB PE=3 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 1.045e-88
Identity = 158/273 (57.88%), Postives = 210/273 (76.92%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ+ AV++VA AI RSRAGL+DP++PI SF+F+GPTGVGKTEL+K LA+++F+ E A+VRIDMSE+MEKH+VSRL+GAPPGYVGYE+GG LTE VRRRPY+V+L DE+EKAH DVFN+ LQ+LDDGR+TD QGRTV F NTV+IMTSN+G+  I          E  Y  +K+ VM      FRPEF+NR+DE +VF PLD+  I +I  +QL R+ +R+A+R  ++ ++D A+  +   G+D  +GARP+KR IQQ +EN LA+ IL G+
Sbjct:  570 VIGQNEAVEAVANAILRSRAGLADPNKPIGSFLFLGPTGVGKTELSKTLANFLFDDENAIVRIDMSEFMEKHSVSRLVGAPPGYVGYEQGGYLTEAVRRRPYSVVLLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGAHLIQE------NAEITYLAMKEMVMSVVSQHFRPEFINRIDETVVFHPLDQQHIRAIANIQLQRLIRRLAERGYQVTISDTALDHISQAGFDSLFGARPLKRAIQQELENPLAQQILSGK 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BACAN (Chaperone protein clpB OS=Bacillus anthracis GN=clpB PE=3 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 1.365e-88
Identity = 162/273 (59.34%), Postives = 217/273 (79.49%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILN-MDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ+ AV  V++A+ R+RAG+ DP+RPI SF+F+GPTGVGKTELAK LA  +F++EE ++RIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTE VRR+PY+VIL DEIEKAH +VFN+ LQ+LDDGR+TDSQGRTV F NTVIIMTSN+GS ++L+ ++++   KE +    ++ VM   R  FRPEF+NRVDE I+F+PL  ++I  IV   +  +Q R+ADR + +++T+AA + +   G+DP YGARP+KR +Q+ VE +LA+ ++ G
Sbjct:  576 VIGQEEAVSLVSDAVLRARAGIKDPNRPIGSFIFLGPTGVGKTELAKTLAQSLFDSEEQMIRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHPEVFNILLQMLDDGRITDSQGRTVDFKNTVIIMTSNIGSAHLLDGLEEDGSIKEES----RELVMGQLRGHFRPEFLNRVDEIILFKPLTTNEIKGIVDKIVKELQGRLADRHITVKLTEAAKEFVVEAGFDPMYGARPLKRYVQRQVETKLARELIAG 844          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_CLOTE (Chaperone protein clpB OS=Clostridium tetani GN=clpB PE=3 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 2.328e-88
Identity = 156/273 (57.14%), Postives = 215/273 (78.75%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD AV++V+ A+ R+RAG+ DP +PI SF+F+GPTGVGKTELAK L   +F++EE ++RIDMSEYMEK++VSRLIGAPPGYVGYEEGGQLTE VRR+PY+VILFDEIEKAH DVFN+FLQILDDGR+TD++G+TV F N +IIMTSN+GS Y+L    E   ++   ET+K +V +A +  F+PEF+NR+D+ I+F+PL   +I+ I+ + L  ++ R+ DR + + VT+ A +L+   GYD  YGARP+KR I+  +E ++AK I++G+
Sbjct:  576 VIGQDEAVEAVSNAVLRARAGMKDPQKPIGSFIFLGPTGVGKTELAKTLCKNLFDSEENIIRIDMSEYMEKYSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILFDEIEKAHDDVFNIFLQILDDGRLTDNKGKTVDFKNCIIIMTSNIGSSYLL----ENKKEDGIDETVKNKVSNALKDRFKPEFLNRLDDIIMFKPLTNREITKIIDIFLQDIENRLKDRNITLIVTENAKELMAKEGYDAIYGARPLKRYIENILETKIAKQIIKGD 844          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RICCN (Chaperone protein clpB OS=Rickettsia conorii GN=clpB PE=3 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 3.040e-88
Identity = 151/273 (55.31%), Postives = 217/273 (79.49%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD A+K V++A++RSRAG+ D +RP+ SF+F+GPTGVGKTEL KALA ++F+   A++RIDMSEYMEKHA+SRLIGAPPGY+GY++GG LTE VRRRPY VILFDE+EKAH D+FN+ LQILD+GR+TDSQG TV F NT+I++TSN+G++ ++N  ++    E  Y+ +K  VM+  + +F+PEF+NR+DE I+F  L+R+ I  IV++QL+ ++K +  + + ++  ++A+  L   GYDP++GARP+KR+IQ+ ++N LAK IL GE
Sbjct:  569 VIGQDKAIKGVSDAVRRSRAGIQDINRPLGSFLFLGPTGVGKTELTKALAGFLFDDRNAILRIDMSEYMEKHAISRLIGAPPGYIGYDQGGVLTEAVRRRPYQVILFDEVEKAHPDIFNIMLQILDEGRLTDSQGITVDFKNTIIVLTSNLGAEILVNQKED----EDTYK-VKDEVMEYVKAVFKPEFLNRLDEIILFHRLNRNNIHDIVKIQLESLKKILLAQNIILEFDESALNYLAEKGYDPSFGARPLKRLIQREIQNNLAKMILAGE 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RICBR (Chaperone protein clpB OS=Rickettsia bellii (strain RML369-C) GN=clpB PE=3 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 3.970e-88
Identity = 152/273 (55.68%), Postives = 218/273 (79.85%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD A+KSV++A++RSRAG+ D +RP+ SF+F+GPTGVGKTEL KALA ++F+   A++RIDMSEYMEKHA+SRLIGAPPGYVGY++GG LTE VRRRPY VILFDE+EKAH D+FN+ LQILD+GR+TDSQG TV F NT+I++TSN+G++ ++N  +     E  Y+ +K +VM+  +++F+PEF+NR+DE I+F  L++  I  IV++QL+ ++K ++ + + ++  + A+  L   GYDP++GARP+KR+IQ+ ++N LAK IL GE
Sbjct:  569 VIGQDEAIKSVSDAVRRSRAGIQDINRPLGSFLFLGPTGVGKTELTKALAGFLFDDRNAILRIDMSEYMEKHAISRLIGAPPGYVGYDQGGVLTEAVRRRPYQVILFDEVEKAHPDIFNIMLQILDEGRLTDSQGITVDFKNTIIVLTSNLGAEILVNQKE----GEDTYK-VKDQVMEYVKMVFKPEFLNRLDEIILFHRLNQSNIHDIVKIQLEGLKKILSAQNIILEFDEPALNYLAEKGYDPSFGARPLKRLIQREIQNNLAKMILAGE 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_COREF (Chaperone protein clpB OS=Corynebacterium efficiens GN=clpB PE=3 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 3.970e-88
Identity = 150/275 (54.55%), Postives = 217/275 (78.91%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQ  AV +V++A++RSRAG++DP+RP  SF+F+GPTGVGKTELAKA++ ++F+ E A+VRIDMSEY EKH+V+RL+GAPPGYVGY++GGQLTE VRRRPY  +LFDE+EKAH DVF++ LQ+LDDGR+TD QGRTV F NT++I+TSN+G+                    ++++MDA ++ F+PEF+NR+D+ +VF PL ++Q++SIV +Q+ ++ +R++DR++ ++V+DAA   L   GYDP YGARP++R+IQQ + ++LAK +L GE +
Sbjct:  573 VVGQHEAVTAVSDAVRRSRAGVADPNRPTGSFLFLGPTGVGKTELAKAVSEFLFDDERAMVRIDMSEYSEKHSVARLVGAPPGYVGYDQGGQLTEAVRRRPYTTVLFDEVEKAHPDVFDILLQVLDDGRLTDGQGRTVDFRNTILILTSNLGA-----------------GGTREQMMDAVKMAFKPEFINRLDDIVVFDPLSQEQLASIVEIQISQLAERLSDRRLTLRVSDAAKLWLAERGYDPAYGARPLRRLIQQAIGDQLAKELLAGEIR 830          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PROMA (Chaperone protein clpB OS=Prochlorococcus marinus GN=clpB PE=3 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.509e-87
Identity = 151/273 (55.31%), Postives = 218/273 (79.85%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ  AV++VA++IQRSR GLSDP RP+ SF+ +GPTGVGKTEL+K+LA  +F++E+A++RIDMSEYMEKH++SRLIGAPPGYVGYE GGQL+E VRR PY+VILFDE+EKA+SDV N+ LQILD+GR+TD +G+ ++F NT+II+TSNVGS+ I+ M +    K+  YE I++ V +  +  F+PEF+NR+DE I+F+ L ++ +  IV+LQ+D+V+ R+ D+ +++++ +  I  +   GY+P YGARP+KR+IQ  +E +LAK IL+ +
Sbjct:  577 VIGQKQAVQAVADSIQRSRTGLSDPSRPMGSFLLLGPTGVGKTELSKSLAKELFDSEKAMIRIDMSEYMEKHSISRLIGAPPGYVGYESGGQLSEAVRRNPYSVILFDEVEKANSDVLNIMLQILDEGRLTDGKGKNINFKNTIIILTSNVGSESIIEMTN----KKNEYELIEEVVRNQLKNYFKPEFLNRLDEQIIFKSLKKEDLKKIVKLQIDKVKARLKDKGLEIELNEKVIDWIADKGYNPIYGARPIKRIIQTKLETKLAKMILKSK 845          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB_STRCO6.125e-8955.27Chaperone protein clpB OS=Streptomyces coelicolor ... [more]
CLPB_RICFE8.000e-8955.68Chaperone protein clpB OS=Rickettsia felis GN=clpB... [more]
CLPB_BACCR8.000e-8959.34Chaperone protein clpB OS=Bacillus cereus (strain ... [more]
CLPB_HAEDU1.045e-8857.88Chaperone protein clpB OS=Haemophilus ducreyi GN=c... [more]
CLPB_BACAN1.365e-8859.34Chaperone protein clpB OS=Bacillus anthracis GN=cl... [more]
CLPB_CLOTE2.328e-8857.14Chaperone protein clpB OS=Clostridium tetani GN=cl... [more]
CLPB_RICCN3.040e-8855.31Chaperone protein clpB OS=Rickettsia conorii GN=cl... [more]
CLPB_RICBR3.970e-8855.68Chaperone protein clpB OS=Rickettsia bellii (strai... [more]
CLPB_COREF3.970e-8854.55Chaperone protein clpB OS=Corynebacterium efficien... [more]
CLPB_PROMA1.509e-8755.31Chaperone protein clpB OS=Prochlorococcus marinus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top