DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB1_CHLTE (Probable chaperone protein clpB 1 OS=Chlorobium tepidum GN=clpB1 PE=3 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 2.573e-87
Identity = 153/275 (55.64%), Postives = 214/275 (77.82%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDD--ETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQD AV++V++A++RSRAG+ D  RPI SF+F+GPTGVGKTELA+ LA Y+F+ E+AL+RIDMSEYME H VSRL+GAPPGYVGYEEGGQLTE VRR+P++V+L DEIEKAH DVFN+ LQILDDGR+TDS+GRTV+F NT+IIMTSN+G+Q I +  +  E    + A   +K+++    +   RPEF+NR+DE I+F PL R+ +  IV +Q +R+++    +++ ++++D A+  L   G+DP +GARP+KRV+Q+ + N L++ IL G+
Sbjct:  143 VVGQDEAVRAVSDAVKRSRAGMGDEKRPIGSFIFLGPTGVGKTELARTLAEYLFDDEDALIRIDMSEYMEAHTVSRLVGAPPGYVGYEEGGQLTEAVRRKPFSVVLLDEIEKAHPDVFNILLQILDDGRLTDSKGRTVNFKNTIIIMTSNIGAQLIQSEMEHLEGRDADAALAGLKEKLFQLLKQQVRPEFLNRIDEVILFTPLTRENLREIVTIQFNRIKETARRQRITLEISDEALMWLAKTGFDPAFGARPLKRVMQRQITNRLSEMILAGQ 417          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_OCEIH (Chaperone protein clpB OS=Oceanobacillus iheyensis GN=clpB PE=3 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 7.488e-87
Identity = 153/275 (55.64%), Postives = 214/275 (77.82%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFP---KETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ  AV +VA+AI+R+RAGL DP RPI SF+F+GPTGVGKTELA+ALA  MF  E+A++RIDMSEYME+HA SRL+G+PPGYVGY+EGGQLTE VRR+PY+V+L DE+EKAH +VFN+ LQ+L+DGR+TDS+GR V F NTVIIMTSNVG+  +       F    +E  Y+ +K +V++  +  FRPEF+NR+DE IVF  L+++ +  IV L + ++QKR+ ++ + + +TD AI+ + + G+DP YGARP++R IQ+ +E+ L++ +LRG
Sbjct:  513 VIGQSEAVNAVAKAIRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEVMFADEDAMIRIDMSEYMERHATSRLVGSPPGYVGYDEGGQLTEKVRRKPYSVVLLDEVEKAHPEVFNILLQVLEDGRLTDSKGRVVDFRNTVIIMTSNVGASELKRNKYVGFALDNEEKDYKDMKSKVIEELKKAFRPEFLNRIDETIVFHSLEKEHMKDIVTLMVQQLQKRLKEQDLHLSLTDKAIEKIANEGFDPEYGARPLRRSIQKNIEDLLSEELLRG 787          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPC_STAES (ATP-dependent Clp protease ATP-binding subunit clpC OS=Staphylococcus epidermidis (strain ATCC 12228) GN=clpC PE=3 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.277e-86
Identity = 155/278 (55.76%), Postives = 216/278 (77.70%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETF------PKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ+ AV S+++A++R+RAGL DP RPI SF+F+GPTGVGKTELA+ALA  MF  ++A++R+DMSE+MEKHAVSRL+GAPPGYVG+++GGQLTE VRR+PY+VILFDEIEKAH DVFN+ LQ+LDDG +TD++GRTV F NTVIIMTSNVG+Q    + D+ F       + + YET+++ +M   +  FRPEF+NRVD+ IVF  L +D++  IV + ++++  R++++ + + VTD A + +   GYDP YGARP+ R IQ+ VE+ L++ IL G
Sbjct:  510 VIGQNDAVNSISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGEDDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDDGGQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTVIIMTSNVGAQ---ELQDQRFAGFGGASEGSDYETVRKTMMKELKNSFRPEFLNRVDDIIVFHKLTKDELKEIVTMMVNKLTHRLSEQNINIVVTDKAKEKIAEEGYDPEYGARPLIRAIQKTVEDNLSELILDG 784          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPC_STAEQ (ATP-dependent Clp protease ATP-binding subunit clpC OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=clpC PE=3 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.277e-86
Identity = 155/278 (55.76%), Postives = 216/278 (77.70%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETF------PKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ+ AV S+++A++R+RAGL DP RPI SF+F+GPTGVGKTELA+ALA  MF  ++A++R+DMSE+MEKHAVSRL+GAPPGYVG+++GGQLTE VRR+PY+VILFDEIEKAH DVFN+ LQ+LDDG +TD++GRTV F NTVIIMTSNVG+Q    + D+ F       + + YET+++ +M   +  FRPEF+NRVD+ IVF  L +D++  IV + ++++  R++++ + + VTD A + +   GYDP YGARP+ R IQ+ VE+ L++ IL G
Sbjct:  510 VIGQNDAVNSISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGEDDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDDGGQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTVIIMTSNVGAQ---ELQDQRFAGFGGASEGSDYETVRKTMMKELKNSFRPEFLNRVDDIIVFHKLTKDELKEIVTMMVNKLTHRLSEQNINIVVTDKAKEKIAEEGYDPEYGARPLIRAIQKTVEDNLSELILDG 784          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RICPR (Chaperone protein clpB OS=Rickettsia prowazekii GN=clpB PE=3 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.277e-86
Identity = 150/273 (54.95%), Postives = 214/273 (78.39%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD A+K V++A++RSR+G+ D +RP+ SF+F+GPTGVGKTEL KALA ++F+   AL+RIDMSEYMEKH++SRLIGAPPGY+GY++GG LTE VRRRPY VILFDE+EKAH D+FN+ LQILD+GR+TDSQG TV F NT+I++TSN+G++ ++N  +     E  Y+ ++  VM   R +F+PEF+NR+DE I+F  L+R+ I  IV++QL  ++K +  + + ++  ++A+  L   GYDP++GARP+KR+IQ+ ++N LAK IL GE
Sbjct:  569 VIGQDEAIKGVSDAVRRSRSGIQDINRPLGSFLFLGPTGVGKTELTKALAGFLFDDRNALLRIDMSEYMEKHSISRLIGAPPGYIGYDQGGVLTESVRRRPYQVILFDEVEKAHLDIFNIMLQILDEGRLTDSQGITVDFKNTIIVLTSNLGAEILVNQKE----GEDTYK-VRDEVMQYVRAVFKPEFLNRLDEIILFHRLNRNNIHDIVKIQLGSLKKILLQQNIILEFDESALNYLAEKGYDPSFGARPLKRLIQREIQNNLAKMILAGE 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPC_STAHJ (ATP-dependent Clp protease ATP-binding subunit clpC OS=Staphylococcus haemolyticus (strain JCSC1435) GN=clpC PE=3 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.668e-86
Identity = 157/278 (56.47%), Postives = 215/278 (77.34%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETF------PKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ+ AV S+++A++R+RAGL DP RPI SF+F+GPTGVGKTELA+ALA  MF  E+A++R+DMSE+MEKHAVSRL+GAPPGYVG++EGGQLTE VRR+PY+VILFDEIEKAH DVFN+ LQ+LDDG +TD++GR V F NTVIIMTSNVG+Q    + D+ F       +   YETI++ +M   +  FRPEF+NRVD+ IVF  L +D++  IV + ++++ +R++++ + + VTD A + +   GYDP YGARP+ R IQ+ VE+ L++ IL G
Sbjct:  510 VIGQNDAVTSISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGEEDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDEGGQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRQVDFRNTVIIMTSNVGAQ---ELQDQRFAGFGGGSEGHDYETIRKTMMKELKNSFRPEFLNRVDDIIVFHKLSKDELKEIVTMMVNKLTQRLSEQDINIVVTDKAKEKIAEEGYDPEYGARPLIRAIQKTVEDNLSELILDG 784          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_RICTY (Chaperone protein clpB OS=Rickettsia typhi GN=clpB PE=3 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 2.179e-86
Identity = 148/273 (54.21%), Postives = 215/273 (78.75%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQD A+K +++A++RSR+G+ D +RP+ SF+F+GPTGVGKTEL KALA ++F+   AL+RIDMSEYMEKH++SRLIGAPPGY+GY++GG LTE VRRRPY VILFDE+EKAH D+FN+ LQILD+GR+T+SQG TV F NT+I++TSN+G++ ++N  ++    E  Y+ +K  VM   R +F+PEF+NR+DE I+F  L+R+ I  IV++QL  ++K +  + + ++  ++A+  L   GYDP++GARP+KR+IQ+ ++N LAK IL G+
Sbjct:  569 VIGQDEAIKGISDAVRRSRSGIQDINRPLGSFLFLGPTGVGKTELTKALAGFLFDDRNALLRIDMSEYMEKHSISRLIGAPPGYIGYDQGGVLTESVRRRPYQVILFDEVEKAHLDIFNIMLQILDEGRLTNSQGITVDFKNTIIVLTSNLGAEILVNQQED----EDTYK-VKDEVMQYVRAVFKPEFLNRLDEIILFHRLNRNNIYDIVKIQLGSLKKILLQQNIILEFNESALNYLAEKGYDPSFGARPLKRLIQREIQNNLAKMILAGK 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPC_BACSU (Negative regulator of genetic competence clpC/mecB OS=Bacillus subtilis GN=clpC PE=1 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 2.845e-86
Identity = 155/279 (55.56%), Postives = 214/279 (76.70%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYI-------LNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQD AV +VA+A++R+RAGL DP RPI SF+F+GPTGVGKTELA+ALA  +F  EE+++RIDMSEYMEKH+ SRL+G+PPGYVGY+EGGQLTE VRR+PY+V+L DEIEKAH DVFN+ LQ+L+DGR+TDS+GRTV F NT++IMTSNVG+  +        N+ DET      ++ +K +VM   +  FRPEF+NR+DE IVF  L++  ++ IV L  D++ KR+ ++ + +++TDAA   +   G D  YGARP++R IQ++VE+ L++ +LRG
Sbjct:  510 VIGQDEAVVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESIFGDEESMIRIDMSEYMEKHSTSRLVGSPPGYVGYDEGGQLTEKVRRKPYSVVLLDEIEKAHPDVFNILLQVLEDGRLTDSKGRTVDFRNTILIMTSNVGASELKRNKYVGFNVQDET----QNHKDMKDKVMGELKRAFRPEFINRIDEIIVFHSLEKKHLTEIVSLMSDQLTKRLKEQDLSIELTDAAKAKVAEEGVDLEYGARPLRRAIQKHVEDRLSEELLRG 784          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_ENTFA (Chaperone protein clpB OS=Enterococcus faecalis GN=clpB PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 2.845e-86
Identity = 155/272 (56.99%), Postives = 207/272 (76.10%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQD AV +V++A+ RSRAGL DP+RP+ SF+F+GPTGVGKTELAKALA  +F++E+ +VRIDMSEYMEKHAVSRL+GAPPGYVGYEEGGQLTE VRR PY ++L DEIEKAH DVFN+ LQ+LDDGR+TDS+GR V F NTV+IMTSN+GSQ +L   +   P+ T  E ++ +VM+  +  F+PEF+NR+D+ I+F PL  D +  I+     ++  R+  +++ +++TD A   +   GY+P YGARP+KR I + VE  LAK I+ G
Sbjct:  573 VIGQDEAVDAVSDAVIRSRAGLQDPNRPLGSFLFLGPTGVGKTELAKALAEDLFDSEDHMVRIDMSEYMEKHAVSRLVGAPPGYVGYEEGGQLTEAVRRNPYTIVLLDEIEKAHPDVFNILLQVLDDGRLTDSKGRVVDFKNTVLIMTSNIGSQLLL---EGVTPEGTIPEEVENQVMNILKGHFKPEFLNRIDDTILFTPLSLDNVKGIIGKMTAQLAHRLEQQEIVLEITDEAKTWIAENGYEPAYGARPLKRFITREVETPLAKEIVSG 841          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_CLOAB (Chaperone protein clpB OS=Clostridium acetobutylicum GN=clpB PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 2.845e-86
Identity = 154/279 (55.20%), Postives = 215/279 (77.06%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYIL------NMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQ  AVKSVA+A+ R+RAGL D  +PI SF+F+GPTGVGKTELAK LA  MF++E+ ++RIDMSEYMEK++VSRLIG+PPGYVGYEEGGQLTE VRR+PY+VILFDEIEKAHSDVFN+FLQI DDGR+TD++G T+ F N++IIMTSN+GS+++L      N+D+ET          K +VM+  +  F+PEF+NR+D+ I+F+PL  ++I  I+ + L+ ++ ++ ++ +K+ + + A +++   GYDP YGARP+KR I+  +E  +AK  + GE
Sbjct:  576 VVGQTEAVKSVADAVIRARAGLKDMSKPIGSFIFLGPTGVGKTELAKTLARVMFDSEDNIIRIDMSEYMEKYSVSRLIGSPPGYVGYEEGGQLTEAVRRKPYSVILFDEIEKAHSDVFNIFLQIFDDGRLTDNKGNTIDFKNSIIIMTSNIGSEHLLNNKGVSNVDEET----------KDKVMNELKGRFKPEFLNRLDDIIMFKPLSINEIGKIIDIFLENIKSKLKEKNIKIDIAEEAKKIIAEEGYDPVYGARPLKRYIENTIETHIAKMFISGE 844          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB1_CHLTE2.573e-8755.64Probable chaperone protein clpB 1 OS=Chlorobium te... [more]
CLPB_OCEIH7.488e-8755.64Chaperone protein clpB OS=Oceanobacillus iheyensis... [more]
CLPC_STAES1.277e-8655.76ATP-dependent Clp protease ATP-binding subunit clp... [more]
CLPC_STAEQ1.277e-8655.76ATP-dependent Clp protease ATP-binding subunit clp... [more]
CLPB_RICPR1.277e-8654.95Chaperone protein clpB OS=Rickettsia prowazekii GN... [more]
CLPC_STAHJ1.668e-8656.47ATP-dependent Clp protease ATP-binding subunit clp... [more]
CLPB_RICTY2.179e-8654.21Chaperone protein clpB OS=Rickettsia typhi GN=clpB... [more]
CLPC_BACSU2.845e-8655.56Negative regulator of genetic competence clpC/mecB... [more]
CLPB_ENTFA2.845e-8656.99Chaperone protein clpB OS=Enterococcus faecalis GN... [more]
CLPB_CLOAB2.845e-8655.20Chaperone protein clpB OS=Clostridium acetobutylic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top