DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_BLOFL (Chaperone protein clpB OS=Blochmannia floridanus GN=clpB PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 2.845e-86
Identity = 154/271 (56.83%), Postives = 206/271 (76.01%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKM-KMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGIL 870
            V+GQD AV+ ++ AI+RSR+GLSDP RPI SFMF+GPTGVGKTEL KAL+ ++F+T+ A+VRIDMSE+MEKH+VS+L+GAPPGY+GYE G  LTE +RRRPY+++L DEIEKAH DVFN+ LQ+LDDGR+TD+QGR V F NTVIIMTSN+GS  I    D      + Y+T+K+ V++     FRPEF+NR+DE +VF PL    +  I  +QL  +  R+ +R   +  +T+ A+  L  +G+DP YGARP+KR+IQQY+EN L++ IL
Sbjct:  572 VIGQDEAVRVISNAIRRSRSGLSDPKRPIGSFMFLGPTGVGKTELCKALSQFLFDTDNAMVRIDMSEFMEKHSVSKLLGAPPGYIGYESGAYLTESIRRRPYSIVLLDEIEKAHLDVFNILLQVLDDGRLTDNQGRMVDFNNTVIIMTSNLGSDLIQKKFD-----ISDYDTMKKTVLNVVNQYFRPEFINRIDEIVVFHPLSIKHLIDIANIQLKYLYSRLEERGYPRTGITNKALLFLSKIGFDPIYGARPLKRIIQQYIENPLSQKIL 837          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_STRAL (Chaperone protein clpB OS=Streptomyces albus G GN=clpB PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 4.853e-86
Identity = 150/275 (54.55%), Postives = 212/275 (77.09%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            ++GQ  AV++V++A+ R+RAG++DP RP  SF+F+GPTGVGKTELAKALA ++F+ E A++RIDMSEY EKH+V+RL+GAPPGYVGYEEGGQLTE VRRRPY+V+L DE+EKAH  VF++ LQ+LDDGR+TD QGRTV F NT++++TSN+GSQY++    E        E  +++VM+  R  F+PEF+NR+D+ ++F  LD D+++ I  LQ+  + +R+ADR++ + VT  A+  L   G+DP YGARP++R+IQ  + + LAK IL GE +
Sbjct:  571 LIGQSEAVQAVSDAV-RTRAGIADPDRPTGSFLFLGPTGVGKTELAKALADFLFDDERAMIRIDMSEYGEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVVLLDEVEKAHPGVFDILLQVLDDGRLTDGQGRTVDFRNTILVLTSNLGSQYLVGSAPE--------EEKRRQVMEVVRSSFKPEFLNRLDDLVIFSALDEDELARIAGLQIAGLARRLADRRLSLDVTPEALAWLAKEGFDPAYGARPLRRLIQTAIGDRLAKEILAGEVR 836          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPC_STAS1 (ATP-dependent Clp protease ATP-binding subunit clpC OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=clpC PE=3 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 6.339e-86
Identity = 154/275 (56.00%), Postives = 213/275 (77.45%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETA---YETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            V+GQ  AV S+++A++R+RAGL DP RPI SF+F+GPTGVGKTELA+ALA  MF  ++A++R+DMSE+MEKHAVSRL+GAPPGYVG+++GGQLTE VRR+PY+VILFDEIEKAH DVFN+ LQ+LDDG +TD++GR V F NTVIIMTSNVG+Q + +     F   T    YE+I++ +M   +  FRPEF+NRVD+ IVF  L +D++  IV + ++++  R++++ + + VT+AA + +   GYDP YGARP+ R IQ+ VE+ L++ IL G
Sbjct:  510 VIGQKDAVTSISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGEDDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDDGGQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRRVDFRNTVIIMTSNVGAQELQDQRFAGFGGATEGQDYESIRKTMMKELKNAFRPEFLNRVDDIIVFHKLSKDELKQIVTMMVNKLTNRLSEQDINISVTEAAKEKIAEEGYDPEYGARPLIRAIQKTVEDNLSELILDG 784          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_LACPL (Chaperone protein clpB OS=Lactobacillus plantarum GN=clpB PE=3 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 8.279e-86
Identity = 156/273 (57.14%), Postives = 207/273 (75.82%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYIL-NMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            VVGQD AV +V++A+ RSRAGL DP+RP+ SFMF+GPTGVGKTELAKALA  +F+ ++ +VRIDMSEYMEK +VSRL+GA PGYVGYEEGGQLTE VRR PY+++LFDEIEKAH DVFN+ LQ+LDDGR+TD QGRTV F NT++IMTSN+GS+ +L  +DD+       +    Q+VM   +  F+PEF+NR+D+ I+F PL    I  IV   +DR+  R+ DR++ ++++D A + +   GY+P YGARP++R I  +VE  LAK I+ G
Sbjct:  572 VVGQDAAVDAVSDAVLRSRAGLQDPNRPLGSFMFLGPTGVGKTELAKALAENLFDADDHMVRIDMSEYMEKESVSRLVGAAPGYVGYEEGGQLTEAVRRNPYSIVLFDEIEKAHPDVFNILLQVLDDGRLTDGQGRTVDFKNTILIMTSNLGSELLLAGVDDQGHLSADTH----QQVMQLVQSRFKPEFLNRIDDIIMFTPLQLGAIEEIVVKLIDRLSARLQDREITLKISDEAKKWIAKQGYEPAYGARPLRRFITNHVETPLAKEIIAG 840          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_CORDI (Chaperone protein clpB OS=Corynebacterium diphtheriae GN=clpB PE=3 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 1.412e-85
Identity = 150/275 (54.55%), Postives = 212/275 (77.09%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            VVGQ  AV +V++A++R+RAG++DP+RP  SF+F+GPTGVGKTELAKALA +MF+ + A+VRIDMSEY EKHAV+RL+GAPPGYVGY++GGQLTE VRRRPY V+LFDE+EKAH DVF++ LQ+LD+GR+TD QGRTV F NTV+I+TSN+G+                    K  +MDA +  F+PEF+NR+D+ ++F PL ++Q++ IV +Q+ ++ +R+A R++ + V+D+A   L   GY+P YGARP++R+IQQ + ++LAK +L GE +
Sbjct:  571 VVGQSEAVVAVSDAVRRARAGVADPNRPTGSFLFLGPTGVGKTELAKALAEFMFDDDRAMVRIDMSEYGEKHAVARLVGAPPGYVGYDQGGQLTEAVRRRPYTVVLFDEVEKAHPDVFDILLQVLDEGRLTDGQGRTVDFRNTVLILTSNLGA-----------------GGTKDEMMDAVKRAFKPEFVNRLDDVVIFDPLSQEQLTHIVEIQIAQLAQRLAARRLTLAVSDSAKLWLAERGYEPAYGARPLRRLIQQAIGDQLAKKLLSGEVR 828          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: HS101_ORYSJ (Heat shock protein 101 OS=Oryza sativa subsp. japonica GN=HSP101 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 3.146e-85
Identity = 158/273 (57.88%), Postives = 206/273 (75.46%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQ  AV +VAEA+ RSRAGL  P +P  SF+F+GPTGVGKTELAKALA  +F+ E  LVRIDMSEYME+H+V+RLIGAPPGYVG+EEGGQLTE VRRRPY+VILFDE+EKAH  VFN  LQ+LDDGR+TD QGRTV F NTVIIMTSN+G++++L         + + +  +  VM   R  FRPE +NR+DE ++F PL  +Q+  + RLQ+  V  R+A+R + + VTDAA+ ++ SL YDP YGARP++R I++ V  +L+K +++ E
Sbjct:  572 VVGQAEAVSAVAEAVLRSRAGLGRPQQPTGSFLFLGPTGVGKTELAKALAEQLFDDENLLVRIDMSEYMEQHSVARLIGAPPGYVGHEEGGQLTEQVRRRPYSVILFDEVEKAHVAVFNTLLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGAEHLL----AGMVGKNSMKVARDLVMQEVRRHFRPELLNRLDEIVIFDPLSHEQLRKVARLQMKDVAVRLAERGVALAVTDAALDVILSLSYDPVYGARPIRRWIEKRVVTQLSKMLIQEE 840          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPC_CYACA (ATP-dependent Clp protease ATP-binding subunit clpA homolog OS=Cyanidium caldarium GN=clpC PE=3 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 3.146e-85
Identity = 154/281 (54.80%), Postives = 212/281 (75.44%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYI------LNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            +VGQ+ AV +V++AI+R+R GL +P+RPIASF+F GPTGVGKTEL KA+ASY F +EEA+VR+DMSEYME+H VS+LIG+PPGYVGY EGGQLTE VR+RPY V+LFDEIEKAH DVFN+ LQIL+DGR+TDS+GRT+ F NT++IMTSN+GS+ I      L  + E   +E  Y  ++  V +  +  FRPEF+NRVDE IVF+ L +D++  I  + L  + +R+  + + +QVT+    LL   GY+P+YGARP++R + + +E+ LA+ +L G+ K
Sbjct:  544 IVGQNEAVIAVSKAIRRARVGLKNPNRPIASFIFSGPTGVGKTELTKAMASYFFGSEEAMVRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRKRPYTVVLFDEIEKAHPDVFNLLLQILEDGRLTDSKGRTIDFKNTLLIMTSNIGSKVIEKKGGGLGFELEENIEELQYSRMRNLVNEELKQYFRPEFLNRVDEIIVFRQLTKDEVRDIAHIMLREIFERVKQQGISLQVTERFKNLLIEEGYNPSYGARPLRRALVRLLEDSLAEEVLSGKIK 824          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: HS101_ARATH (Heat shock protein 101 OS=Arabidopsis thaliana GN=HSP101 PE=2 SV=2)

HSP 1 Score: 315.464 bits (807), Expect = 4.109e-85
Identity = 160/273 (58.61%), Postives = 203/273 (74.36%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQ+ AV +V+EAI RSRAGL  P +P  SF+F+GPTGVGKTELAKALA  +F+ E  LVRIDMSEYME+H+VSRLIGAPPGYVG+EEGGQLTE VRRRPY VILFDE+EKAH  VFN  LQ+LDDGR+TD QGRTV F N+VIIMTSN+G++++L         +   E  +  VM   R  FRPE +NR+DE +VF PL  DQ+  + RLQ+  V  R+A+R + + VTDAA+  + +  YDP YGARP++R +++ V  EL+K ++R E
Sbjct:  571 VVGQNQAVNAVSEAILRSRAGLGRPQQPTGSFLFLGPTGVGKTELAKALAEQLFDDENLLVRIDMSEYMEQHSVSRLIGAPPGYVGHEEGGQLTEAVRRRPYCVILFDEVEKAHVAVFNTLLQVLDDGRLTDGQGRTVDFRNSVIIMTSNLGAEHLL----AGLTGKVTMEVARDCVMREVRKHFRPELLNRLDEIVVFDPLSHDQLRKVARLQMKDVAVRLAERGVALAVTDAALDYILAESYDPVYGARPIRRWMEKKVVTELSKMVVREE 839          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PORGI (Chaperone protein clpB OS=Porphyromonas gingivalis GN=clpB PE=3 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 5.366e-85
Identity = 158/274 (57.66%), Postives = 203/274 (74.09%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYI----LNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGIL 870
            V+GQD A+++VA+A++RSRAGL DP RPI SF+F+G TGVGKTELA+ALA  +F+ E  L RIDMSEY EK + +RLIGAPPGYVGY+EGGQLTE +RR+PY+V+LFDEIEKAH DVFNV LQ+LDDGR+TD++G  V+F NT+IIMTSN+GS  I     N+  E     TA       VM   +   RPEF+NR+DE IVF PL   +I  IVRLQLD + +++AD  + +  T+A +      GYDP +GARPVKRV+Q++V NEL+K +L
Sbjct:  568 VIGQDEAIRAVADAVRRSRAGLQDPKRPIGSFIFLGTTGVGKTELARALAELLFDDESMLTRIDMSEYQEKFSATRLIGAPPGYVGYDEGGQLTEAIRRKPYSVVLFDEIEKAHPDVFNVLLQVLDDGRLTDNKGHVVNFKNTLIIMTSNLGSDIIRERMQNLTAENRRSLTA--RTADEVMQLLKHTIRPEFLNRIDETIVFTPLTEKEIYEIVRLQLDGIVRQLADNDVVLHYTEAVVTFAAREGYDPQFGARPVKRVLQRFVLNELSKALL 839          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPAB_SOLLC (ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic OS=Solanum lycopersicum GN=CD4B PE=3 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 5.366e-85
Identity = 153/281 (54.45%), Postives = 213/281 (75.80%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYI------LNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            ++GQD AVK+++ AI+R+R GL +P+RPIASF+F GPTGVGK+ELAKALA+Y F +EEA++R+DMSE+ME+H VS+LIG+PPGYVGY EGGQLTE VRRRPY V+LFDEIEKAH DVFN+ LQIL+DGR+TDS+GRTV F NT++IMTSNVGS  I      +  D +   K+++Y  IK  V +  +  FRPEF+NR+DE IVF+ L + ++  I  + L  V +R+  +++++QVT+     +   GY+P+YGARP++R I + +E+ +A+ +L  E K
Sbjct:  608 IIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDLDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFERLKVKEIELQVTERFRDRVVDEGYNPSYGARPLRRAIMRLLEDSMAEKMLANEIK 888          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB_BLOFL2.845e-8656.83Chaperone protein clpB OS=Blochmannia floridanus G... [more]
CLPB_STRAL4.853e-8654.55Chaperone protein clpB OS=Streptomyces albus G GN=... [more]
CLPC_STAS16.339e-8656.00ATP-dependent Clp protease ATP-binding subunit clp... [more]
CLPB_LACPL8.279e-8657.14Chaperone protein clpB OS=Lactobacillus plantarum ... [more]
CLPB_CORDI1.412e-8554.55Chaperone protein clpB OS=Corynebacterium diphther... [more]
HS101_ORYSJ3.146e-8557.88Heat shock protein 101 OS=Oryza sativa subsp. japo... [more]
CLPC_CYACA3.146e-8554.80ATP-dependent Clp protease ATP-binding subunit clp... [more]
HS101_ARATH4.109e-8558.61Heat shock protein 101 OS=Arabidopsis thaliana GN=... [more]
CLPB_PORGI5.366e-8557.66Chaperone protein clpB OS=Porphyromonas gingivalis... [more]
CLPAB_SOLLC5.366e-8554.45ATP-dependent Clp protease ATP-binding subunit clp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top