DC900341

Overview
NameDC900341
Unique NameDC900341
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1583
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5657 contig Csv1_Contig5657:1..1588. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG_SOLME (Anthocyanidin 3-O-glucosyltransferase OS=Solanum melongena GN=GT PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.147e-24
Identity = 56/126 (44.44%), Postives = 80/126 (63.49%), Query Frame = 1
Query:  838 RAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK 1215
            ++V+Y+SFG++T L   ++      L   K  F+W +R + V    +     +E TKE G +VSW PQ E+LAH++V  F+TH GWNS LE I  GVPMIC P+F DQ++NSR V  VW +GL ++
Sbjct:  258 KSVVYLSFGTVTTLPPNEIGSIAEALETKKTPFIWSLRNNGV---KNLPKGFLERTKEFGKIVSWAPQLEILAHKSVGVFVTHCGWNSILEGISFGVPMICRPFFGDQKLNSRMVESVWEIGLQIE 380          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: HQGT_RAUSE (Hydroquinone glucosyltransferase OS=Rauvolfia serpentina GN=AS PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.957e-24
Identity = 66/144 (45.83%), Postives = 88/144 (61.11%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPD----------SVIGEGDALAELVEG----TKERGLLV-SWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK 1215
            +P  +VL++SFGS   +   Q IE   GL  S+QRFLWV+R            S+  + DALA L EG    TK R LLV SW PQ E+L+H +  GFLTH GWNS LES+V GVP+I WP +A+Q++N+  ++E   + L  K
Sbjct:  260 QPRGSVLFISFGSGGAVSHNQFIELALGLEMSEQRFLWVVRSPNDKIANATYFSIQNQNDALAYLPEGFLERTKGRCLLVPSWAPQTEILSHGSTGGFLTHCGWNSILESVVNGVPLIAWPLYAEQKMNAVMLTEGLKVALRPK 403          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: HTGT_ARATH (N-hydroxythioamide S-beta-glucosyltransferase OS=Arabidopsis thaliana GN=UGT74B1 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.694e-24
Identity = 62/140 (44.29%), Postives = 85/140 (60.71%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSV--IGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRNVVE 1242
            K  ++V +VSFGS  +L   QL E    L +S   FLWVI+   +  + EG      VE TK+R LLVSW  Q EVLAH+++  FLTH GWNSTLE +  GVPM+  P ++DQ  +++FV EVW +G   K+     +V+
Sbjct:  272 KQAQSVAFVSFGSFGILFEKQLAEVAIALQESDLNFLWVIKEAHIAKLPEG-----FVESTKDRALLVSWCNQLEVLAHESIGCFLTHCGWNSTLEGLSLGVPMVGVPQWSDQMNDAKFVEEVWKVGYRAKEEAGEVIVK 406          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG5_MANES (Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot esculenta GN=GT5 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 7.436e-24
Identity = 73/196 (37.24%), Postives = 101/196 (51.53%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVI-----------GEGDALAELVEGTKER----GLLV-SWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSE-----VWNLGLDMKDVCDRNVVEKMVNDLMV-ERKEEFXXXXXXXXXXXXXXXNEGGPSY 1350
            +P  +V+YVSFGS   L   Q+IE   GL  S+QRF+WV+R  +V            G  D      EG   R    GL+V  W PQ  +++H +V  FL+H GWNS LESI AGVP+I WP +A+Q++N+  ++E     V    L  K+V  R  +E+M+  +MV E   E                NEGG S+
Sbjct:  268 QPKESVVYVSFGSGGTLSLEQMIELAWGLERSQQRFIWVVRQPTVKTGDAAFFTQGDGADDMSGYFPEGFLTRIQNVGLVVPQWSPQIHIMSHPSVGVFLSHCGWNSVLESITAGVPIIAWPIYAEQRMNATLLTEELGVAVRPKNLPAKEVVKREEIERMIRRIMVDEEGSEIRKRVRELKDSGEKALNEGGSSF 463          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: ANGLT_ROSHC (Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hybrid cultivar GN=RhGT1 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.268e-23
Identity = 70/194 (36.08%), Postives = 105/194 (54.12%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRP---DSVIGEGDALAEL-----VEGTKERGLLV-SWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD----VCDRNVVEKMVNDLM-VERKEEFXXXXXXXXXXXXXXXNEGGPSYCNLDRL 1368
            +P  +V+++ FGS+ +    QL     GL  S QRFLWV+R    + +  E  +L E+     VE TK+RGL+V  W PQ EVL+H +V GF+TH GWNS LE++  GVPM+ WP +A+Q++   F+ E   + + +K+        + +EK V +LM  E  +E                 EGG S  +L +L
Sbjct:  273 QPKDSVVFLCFGSMGVFSIKQLEAMALGLEKSGQRFLWVVRNPPIEELPVEEPSLEEILPKGFVERTKDRGLVVRKWAPQVEVLSHDSVGGFVTHCGWNSVLEAVCNGVPMVAWPLYAEQKLGRVFLVEEMKVAVGVKESETGFVSADELEKRVRELMDSESGDEIRGRVSEFSNGGVKAKEEGGSSVASLAKL 466          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: ZOX_PHAVU (Zeatin O-xylosyltransferase OS=Phaseolus vulgaris GN=ZOX1 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.657e-23
Identity = 68/161 (42.24%), Postives = 93/161 (57.76%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRP----DSVIGEGDALAELVEGTKER----GLLV-SWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD------VCDRNVVEKMVNDLMVERKE 1278
            +V+YVSFG+ T L+  Q+ E   GL  SKQ+F+WV+R     D   G      EL EG +ER    GL+V  W PQ E+L+H +  GF++H GWNS LES+  GVPM  W   +DQ  N+  V++V  +GL +KD      +   +V+E  V  LM E KE
Sbjct:  257 SVIYVSFGTTTALRDEQIQELATGLEQSKQKFIWVLRDADKGDIFDGSEAKRYELPEGFEERVEGMGLVVRDWAPQMEILSHSSTGGFMSHCGWNSCLESLTRGVPMATWAMHSDQPRNAVLVTDVLKVGLIVKDWEQRKSLVSASVIENAVRRLM-ETKE 416          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: LGT_CITUN (Limonoid UDP-glucosyltransferase OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.657e-23
Identity = 65/198 (32.83%), Postives = 107/198 (54.04%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRP---DSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDM------KDVCDRNVVEKMVNDLMVERKE-EFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDIKMMS 1392
            KP  +V+Y+SFG++  LK  Q+ E  + L++S   FLWV++P   DS +   D     +E   ++G +V W PQE+VLAH +VA F+TH GWNST+ES+ +GVP+I +P + DQ  ++ ++ +V+  GL +        +  R+ VEK + +     K                    +GG S  N+   +D+++  S
Sbjct:  271 KPPSSVVYISFGTVVYLKQEQVEEIGYALLNSGISFLWVMKPPPEDSGVKIVDLPDGFLEKVGDKGKVVQWSPQEKVLAHPSVACFVTHCGWNSTMESLASGVPVITFPQWGDQVTDAMYLCDVFKTGLRLCRGEAENRIISRDEVEKCLLEATAGPKAVALEENALKWKKEAEEAVADGGSSDRNIQAFVDEVRRTS 468          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UGFGT_ARATH (Flavonoid 3-O-glucosyltransferase OS=Arabidopsis thaliana GN=UGT78D2 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.164e-23
Identity = 54/144 (37.50%), Postives = 87/144 (60.42%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLD-MKDVCDRNVVEKMVNDLMVE 1269
            +V Y+SFG++      +L     GL  SK  F+W ++  S++         ++ T+E+G++V W PQ E+L H+A   F+TH GWNS LES+  GVPMIC P+F DQ++N R V  VW +G+  +  V  ++  EK ++ ++V+
Sbjct:  278 SVAYISFGTVMTPPPGELAAIAEGLESSKVPFVWSLKEKSLV---QLPKGFLDRTREQGIVVPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKDGFEKCLDKVLVQ 418          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: COGT3_ARATH (Cytokinin-O-glucosyltransferase 3 OS=Arabidopsis thaliana GN=UGT73C5 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 4.820e-23
Identity = 77/206 (37.38%), Postives = 101/206 (49.03%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKE---------RGLLVS-WVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGL--------------DMKDVCDRNVVEKMVNDLMVERKE--EFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDI 1380
            +VLYV  GSI  L   QL E   GL +S++ F+WVIR        +   ELVE   E         RGLL+  W PQ  +L+H +V GFLTH GWNSTLE I AG+P++ WP FADQ  N + V EV   G+               +  + D+  V+K V +LM E  +  E                 EGG S+ N+  L+ DI
Sbjct:  288 SVLYVCLGSICNLPLSQLKELGLGLEESQRPFIWVIRG------WEKYKELVEWFSESGFEDRIQDRGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPLLTWPLFADQFCNEKLVVEVLKAGVRSGVEQPMKWGEEEKIGVLVDKEGVKKAVEELMGESDDAKERRRRAKELGDSAHKAVEEGGSSHSNISFLLQDI 487          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG1_MAIZE (Anthocyanidin 3-O-glucosyltransferase OS=Zea mays GN=BZ1 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 6.295e-23
Identity = 58/145 (40.00%), Postives = 79/145 (54.48%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLM 1263
            +P R V YVSFG++   +  +L E   GL DS   FLW +R DS         +   GT   GL+V W PQ  VL H +V  F+TH+GW S LE + +GVPM C P+F DQ++N+R V+ VW  G   +       V   V +L+
Sbjct:  285 QPARGVAYVSFGTVACPRPDELRELAAGLEDSGAPFLWSLREDSWPHLPPGFLDRAAGTGS-GLVVPWAPQVAVLRHPSVGAFVTHAGWASVLEGLSSGVPMACRPFFGDQRMNARSVAHVWGFGAAFEGAMTSAGVATAVEELL 428          
The following BLAST results are available for this feature:
BLAST of DC900341 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
UFOG_SOLME1.147e-2444.44Anthocyanidin 3-O-glucosyltransferase OS=Solanum m... [more]
HQGT_RAUSE1.957e-2445.83Hydroquinone glucosyltransferase OS=Rauvolfia serp... [more]
HTGT_ARATH5.694e-2444.29N-hydroxythioamide S-beta-glucosyltransferase OS=A... [more]
UFOG5_MANES7.436e-2437.24Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot... [more]
ANGLT_ROSHC1.268e-2336.08Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hy... [more]
ZOX_PHAVU1.657e-2342.24Zeatin O-xylosyltransferase OS=Phaseolus vulgaris ... [more]
LGT_CITUN1.657e-2332.83Limonoid UDP-glucosyltransferase OS=Citrus unshiu ... [more]
UGFGT_ARATH2.164e-2337.50Flavonoid 3-O-glucosyltransferase OS=Arabidopsis t... [more]
COGT3_ARATH4.820e-2337.38Cytokinin-O-glucosyltransferase 3 OS=Arabidopsis t... [more]
UFOG1_MAIZE6.295e-2340.00Anthocyanidin 3-O-glucosyltransferase OS=Zea mays ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900341 VSS Citrus sinensis cDNA clone VS28692 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900341 ID=DC900341|Name=DC900341|organism=Citrus sinensis|type=EST|length=1583bp
CTCATATCCTGATCTTTCCTCTCCCATGCCAAAGCCATATGAATTCCATG
CTCAAGCTTGCCGAGATTTTCGGCTTAGCTGGCCTCAAAGTGACCTTCCT
AAACTCCAAGCACAACCACGAACGCCTCATCCGGTACACGGATATCCATG
ANCGTTTTCTGCAGTATTCTGAATTCCAATTTAAGACCATCTCAGATGGT
CTTCCAGCGGATCACCCACGAGCAGGTGACCAATTGATGGAGATGTTCGA
TTCTTTGAGTTTGAATACCAGGCCACTTCTCAAACAGATGCTGATTGACA
CTAGCCCGCCAGTGAGCTGCATCATTGGAGATGCATGTATGGAATTTGTG
GTAGACGTTGCTACTGAACTTGAAATCCCTGTAATCCATTTTCGTGCTAT
AAGTGCTTGTAGCTTCTGGGCATATTTCTCTATCCCTGAAATGATCCAAG
CAGGCGAGCTTCCTATGAAAGCCTACGATGAAGACACGGATCGTCTGATA
ACAAAAGTTCCAGGCATGGAAACTTTTCTGAGATTCCGAGATCTCCCCAG
CTTTTGCCGAGTGAGTGACGTAACCGACCGAGATTTGCAAGTTCTTAAGA
ACGCGACCCAACAGTCCCCTCGAGCCCATGCTTTGATACTCAACACGTTT
GAAGACCTAGAAGAACCAATTCTGTCACATATACGCACCAATGNCCCAAA
GTGTACACAATAGGACCTCTTCACTTGCAGCTCAAGACAGGATTCGCCTC
AACATGATCTCATCGNCATTTCAAAGTCTCCAACAGTCTNTGGGAAGNGG
ACAGAAGTTGCATTGAATGGCTTGGTAAAAGCCTGGGCGGGCTGTACTGT
ACGTAAGCTTTGGTAGCATTACACTGTTGAAAANAGANCAGCTGATTGAG
TTTTGGCACGGTCTTGTAGACAGTAAGCAGCGGTTCTTGTGGGTCATTAG
GCCAGATTCTGTGATTGGCGAAGGTGACGCCCTGGCAGAGCTTGTGGAGG
GCACGAAGGAGAGAGGTCTTTTGGTTAGTTGGGTTCCACAGGAGGAGGTA
CTGGCTCACCAGGCTGTGGCTGGATTCTTGACACACAGCGGCTGGAACTC
AACCTTGGAGAGTATAGTAGCCGGGGTGCCAATGATTTGCTGGCCTTACT
TTGCTGATCAACAGATCAATAGTAGGTTTGTGAGTGAAGTGTGGAATCTT
GGATTGGATATGAAGGATGTGTGCGATAGAAATGTTGTTGAGAAAATGGT
GAATGATCTGATGGTGGAGAGGAAGGAGGAGTTTATGAGAGCAGCTGATC
GGATGGCTACAATGGCTAGAACCACTGCTAATGAAGGTGGACCATCTTAC
TGTAATTTGGACCGTCTGATTGATGATATTAAGATGATGAGCTCCCAAGC
ATGAAAACATATAGCTAAGGTTAGTGCAAGATGTTACTGCTAGATTAAAT
AAATTTTAAAGTTTAGAGATTCTTATCAATAAAAATTAATGTTATATGTA
CATCTGTCTTGATGACTGCTAGTACGCTACTACTAGATTATCTATTGGGA
ATGGCTGCGCTTGGCATTTTGTTAAAAAGTCAT
back to top