DC900341

Overview
NameDC900341
Unique NameDC900341
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1583
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5657 contig Csv1_Contig5657:1..1588. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: IABG2_ARATH (Indole-3-acetate beta-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT75B2 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 6.295e-23
Identity = 61/197 (30.96%), Postives = 104/197 (52.79%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVI-----RPDSVIGEGDALAELVEGTK----ERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD----VCDRNVVEKMVNDLMVERKEEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDI 1380
            K   +V+YVSFG++  L   Q+ E    L++  + FLWVI     R   + GE +   E + G +    E G++VSW  Q EVL H+A+  FLTH GW+S+LES+V GVP++ +P ++DQ  N++ + E+W  G+ +++    + +R  + + +  +M  +  E                 EGG S  N++  +  +
Sbjct:  258 KTESSVIYVSFGTMVELSKKQIEELARALIEGGRPFLWVITDKLNREAKIEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLRHRAIGCFLTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLLEEIWKTGVRVRENSEGLVERGEIMRCLEAVMEAKSVELRENAEKWKRLATEAGREGGSSDKNVEAFVKSL 454          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: COGT1_ARATH (Cytokinin-O-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT73C1 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 8.222e-23
Identity = 74/206 (35.92%), Postives = 101/206 (49.03%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELV------EGTKERGLLVS-WVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGL--------------DMKDVCDRNVVEKMVNDLMVERKE--EFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDIKMM 1389
            +VLYV  GSI  L   QL E   GL +S++ F+WVIR      E   L E +      E  KERGLL++ W PQ  +L H AV GFLTH GWNSTLE I +GVP++ WP F DQ  N +   ++   G+               +  + D+  V+K V +LM +  +  E                 EGG S+ N+  L+ DI  +
Sbjct:  284 SVLYVCLGSICNLPLSQLKELGLGLEESQRPFIWVIRGWEKYNE---LLEWISESGYKERIKERGLLITGWSPQMLILTHPAVGGFLTHCGWNSTLEGITSGVPLLTWPLFGDQFCNEKLAVQILKAGVRAGVEESMRWGEEEKIGVLVDKEGVKKAVEELMGDSNDAKERRKRVKELGELAHKAVEEGGSSHSNITFLLQDIMQL 486          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG2_MAIZE (Anthocyanidin 3-O-glucosyltransferase OS=Zea mays GN=BZ1 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 3.124e-22
Identity = 57/145 (39.31%), Postives = 78/145 (53.79%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLM 1263
            +P R V YVSFG++   +  +L E   GL  S   FLW +R DS         +   GT   GL+V W PQ  VL H +V  F+TH+GW S LE + +GVPM C P+F DQ++N+R V+ VW  G   +       V   V +L+
Sbjct:  285 QPARGVAYVSFGTVACPRPDELRELAAGLEASAAPFLWSLREDSWTLLPPGFLDRAAGTGS-GLVVPWAPQVAVLRHPSVGAFVTHAGWASVLEGVSSGVPMACRPFFGDQRMNARSVAHVWGFGAAFEGAMTSAGVAAAVEELL 428          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG3_MAIZE (Anthocyanidin 3-O-glucosyltransferase OS=Zea mays GN=BZ1 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 4.080e-22
Identity = 57/145 (39.31%), Postives = 78/145 (53.79%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLM 1263
            +P R V YVSFG++   +  +L E   GL  S   FLW +R DS         +   GT   GL+V W PQ  VL H +V  F+TH+GW S LE + +GVPM C P+F DQ++N+R V+ VW  G   +       V   V +L+
Sbjct:  285 QPARGVAYVSFGTVACPRPDELRELAAGLEASGAPFLWSLREDSWTLLPPGFLDRAAGTGS-GLVVPWAPQVAVLRHPSVGAFVTHAGWASVLEGVSSGVPMACRPFFGDQRMNARSVAHVWGFGAAFEGAMTSAGVAAAVEELL 428          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UGAGT_ARATH (Anthocyanin 5-O-glucosyltransferase OS=Arabidopsis thaliana GN=UGT75C1 PE=2 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.187e-21
Identity = 65/189 (34.39%), Postives = 101/189 (53.44%), Query Frame = 1
Query:  838 RAVLYVSFGS-ITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEG-DALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK-----DVCDRNVVEKMVNDLMV--ERKEEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDD 1377
            R+V+Y+S G+    L    +    HG++ + + FLW++R  +   +  +   EL+ G+ +RGL+V W  Q  VLAH AV  F+TH GWNSTLES+ +GVP++ +P FADQ   ++ V + W +G+ +K     DV D   + + +  +M   E  EE                 EGGPS  NL   +D+
Sbjct:  268 RSVIYISLGTHADDLPEKHMEALTHGVLATNRPFLWIVREKNPEEKKKNRFLELIRGS-DRGLVVGWCSQTAVLAHCAVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDV-DGEEIRRCLEKVMSGGEEAEEMRENAEKWKAMAVDAAAEGGPSDLNLKGFVDE 454          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG_VITVI (Anthocyanidin 3-O-glucosyltransferase 2 OS=Vitis vinifera GN=UFGT PE=1 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 1.551e-21
Identity = 48/122 (39.34%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGL 1206
            +V+Y+SFG++T     +++     L  S+  F+W +R  + +   +     +E T+  G++V W PQ EVLAH+AV  F+TH GWNS  ES+  GVP+IC P+F DQ++N R V +V  +G+
Sbjct:  272 SVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGF---LEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGV 390          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: KGLT_PETHY (Kaempferol 3-O-beta-D-galactosyltransferase OS=Petunia hybrida PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.645e-21
Identity = 54/131 (41.22%), Postives = 78/131 (59.54%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRP--DSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK 1215
            +PG +V Y+ FG++      +L      L +SK  FLW ++    S   EG      +E T E G +VSW PQ +VL+H +V  F+ H GWNS LESI AGVP+IC P+F D Q+N+  V +VW +G+ ++
Sbjct:  265 EPG-SVAYIGFGTVATPPPNELKAMAEALEESKTPFLWSLKDLFKSFFPEG-----FLERTSEYGKIVSWAPQVQVLSHGSVGVFINHCGWNSVLESIAAGVPVICRPFFGDHQLNAWMVEKVWKIGVKIE 389          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: FORT_ARATH (Flavonol-3-O-glucoside L-rhamnosyltransferase OS=Arabidopsis thaliana GN=UGT78D1 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 5.892e-21
Identity = 54/143 (37.76%), Postives = 85/143 (59.44%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD-VCDRNVVEKMVNDLMV 1266
            +V Y+SFG++      +L+    GL  SK  F+W ++  +++         ++ T+E+G++V W PQ E+L H+A+   +TH GWNS LES+ AGVPMI  P  AD ++N R V  VW +G+ M + V  +   EK +ND+ V
Sbjct:  272 SVAYISFGTVMEPPPEELVAIAQGLESSKVPFVWSLKEKNMVHLPKGF---LDRTREQGIVVPWAPQVELLKHEAMGVNVTHCGWNSVLESVSAGVPMIGRPILADNRLNGRAVEVVWKVGVMMDNGVFTKEGFEKCLNDVFV 411          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: CZOG_SORBI (Putative cis-zeatin O-glucosyltransferase OS=Sorghum bicolor GN=SB20O07.14 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 5.892e-21
Identity = 59/163 (36.20%), Postives = 91/163 (55.83%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRP-DSVIGEGDA---------LAELVEGTKERGLLVS-WVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK------DVCDRNVVEKMVNDLMV 1266
            +P  +VLYVSFG+ + L   Q+ E    +  SKQRF+WV+R  D      DA         L+E  E T+  GLL++ W PQ E+LAH A A F++H GWNST+ES+  G P++ WP  +DQ  +S  + +    GL ++      D+     ++K++ + M+
Sbjct:  263 QPPASVLYVSFGTTSCLHAEQVAELAAAIKGSKQRFIWVLRDADRADIYADASGESRHAKFLSEFTEETRGIGLLITGWAPQLEILAHGATAAFMSHCGWNSTMESLSHGKPVLAWPMHSDQPWDSELLCKYLKAGLLVRPWEKHADIIPAQAIQKVIEEAML 425          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG_HORVU (Anthocyanidin 3-O-glucosyltransferase OS=Hordeum vulgare GN=BZ1 PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 7.695e-21
Identity = 58/147 (39.46%), Postives = 76/147 (51.70%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKER--GLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLM 1263
            +P R+V YVSFG+    +  +L E   GL  S   FLW +R          +A    G  ER  GL+V W PQ  VL H AV  F+TH+GW S +E + +GVPM C P+F DQ +N+R V+ VW  G        R  V   V  L+
Sbjct:  274 RPARSVAYVSFGTNATARPDELQELAAGLEASGAPFLWSLR--------GVVAAAPRGFLERAPGLVVPWAPQVGVLRHAAVGAFVTHAGWASVMEGVSSGVPMACRPFFGDQTMNARSVASVWGFGTAFDGPMTRGAVANAVATLL 412          
The following BLAST results are available for this feature:
BLAST of DC900341 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
IABG2_ARATH6.295e-2330.96Indole-3-acetate beta-glucosyltransferase 2 OS=Ara... [more]
COGT1_ARATH8.222e-2335.92Cytokinin-O-glucosyltransferase 1 OS=Arabidopsis t... [more]
UFOG2_MAIZE3.124e-2239.31Anthocyanidin 3-O-glucosyltransferase OS=Zea mays ... [more]
UFOG3_MAIZE4.080e-2239.31Anthocyanidin 3-O-glucosyltransferase OS=Zea mays ... [more]
UGAGT_ARATH1.187e-2134.39Anthocyanin 5-O-glucosyltransferase OS=Arabidopsis... [more]
UFOG_VITVI1.551e-2139.34Anthocyanidin 3-O-glucosyltransferase 2 OS=Vitis v... [more]
KGLT_PETHY2.645e-2141.22Kaempferol 3-O-beta-D-galactosyltransferase OS=Pet... [more]
FORT_ARATH5.892e-2137.76Flavonol-3-O-glucoside L-rhamnosyltransferase OS=A... [more]
CZOG_SORBI5.892e-2136.20Putative cis-zeatin O-glucosyltransferase OS=Sorgh... [more]
UFOG_HORVU7.695e-2139.46Anthocyanidin 3-O-glucosyltransferase OS=Hordeum v... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900341 VSS Citrus sinensis cDNA clone VS28692 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900341 ID=DC900341|Name=DC900341|organism=Citrus sinensis|type=EST|length=1583bp
CTCATATCCTGATCTTTCCTCTCCCATGCCAAAGCCATATGAATTCCATG
CTCAAGCTTGCCGAGATTTTCGGCTTAGCTGGCCTCAAAGTGACCTTCCT
AAACTCCAAGCACAACCACGAACGCCTCATCCGGTACACGGATATCCATG
ANCGTTTTCTGCAGTATTCTGAATTCCAATTTAAGACCATCTCAGATGGT
CTTCCAGCGGATCACCCACGAGCAGGTGACCAATTGATGGAGATGTTCGA
TTCTTTGAGTTTGAATACCAGGCCACTTCTCAAACAGATGCTGATTGACA
CTAGCCCGCCAGTGAGCTGCATCATTGGAGATGCATGTATGGAATTTGTG
GTAGACGTTGCTACTGAACTTGAAATCCCTGTAATCCATTTTCGTGCTAT
AAGTGCTTGTAGCTTCTGGGCATATTTCTCTATCCCTGAAATGATCCAAG
CAGGCGAGCTTCCTATGAAAGCCTACGATGAAGACACGGATCGTCTGATA
ACAAAAGTTCCAGGCATGGAAACTTTTCTGAGATTCCGAGATCTCCCCAG
CTTTTGCCGAGTGAGTGACGTAACCGACCGAGATTTGCAAGTTCTTAAGA
ACGCGACCCAACAGTCCCCTCGAGCCCATGCTTTGATACTCAACACGTTT
GAAGACCTAGAAGAACCAATTCTGTCACATATACGCACCAATGNCCCAAA
GTGTACACAATAGGACCTCTTCACTTGCAGCTCAAGACAGGATTCGCCTC
AACATGATCTCATCGNCATTTCAAAGTCTCCAACAGTCTNTGGGAAGNGG
ACAGAAGTTGCATTGAATGGCTTGGTAAAAGCCTGGGCGGGCTGTACTGT
ACGTAAGCTTTGGTAGCATTACACTGTTGAAAANAGANCAGCTGATTGAG
TTTTGGCACGGTCTTGTAGACAGTAAGCAGCGGTTCTTGTGGGTCATTAG
GCCAGATTCTGTGATTGGCGAAGGTGACGCCCTGGCAGAGCTTGTGGAGG
GCACGAAGGAGAGAGGTCTTTTGGTTAGTTGGGTTCCACAGGAGGAGGTA
CTGGCTCACCAGGCTGTGGCTGGATTCTTGACACACAGCGGCTGGAACTC
AACCTTGGAGAGTATAGTAGCCGGGGTGCCAATGATTTGCTGGCCTTACT
TTGCTGATCAACAGATCAATAGTAGGTTTGTGAGTGAAGTGTGGAATCTT
GGATTGGATATGAAGGATGTGTGCGATAGAAATGTTGTTGAGAAAATGGT
GAATGATCTGATGGTGGAGAGGAAGGAGGAGTTTATGAGAGCAGCTGATC
GGATGGCTACAATGGCTAGAACCACTGCTAATGAAGGTGGACCATCTTAC
TGTAATTTGGACCGTCTGATTGATGATATTAAGATGATGAGCTCCCAAGC
ATGAAAACATATAGCTAAGGTTAGTGCAAGATGTTACTGCTAGATTAAAT
AAATTTTAAAGTTTAGAGATTCTTATCAATAAAAATTAATGTTATATGTA
CATCTGTCTTGATGACTGCTAGTACGCTACTACTAGATTATCTATTGGGA
ATGGCTGCGCTTGGCATTTTGTTAAAAAGTCAT
back to top