DC900341

Overview
NameDC900341
Unique NameDC900341
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1583
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5657 contig Csv1_Contig5657:1..1588. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: FLRT_CITMA (Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase OS=Citrus maxima GN=C12RT1 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.713e-13
Identity = 43/124 (34.68%), Postives = 69/124 (55.65%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIR--PDSVIGEGDAL----AELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFV 1182
            K  R+V+Y SFGS       ++ +   GL+ ++  F+W  R  PD  +   +AL    AE +E   +  ++  WVPQ ++L H ++ GFL+H GW S +E +V GVP+I  P   +Q  N++ V
Sbjct:  256 KEPRSVVYASFGSEYFPSTDEIHDIAIGLLLTEVNFIWAFRLHPDEKMTIEEALPQGFAEEIERNNKGMIVQGWVPQAKILRHGSIGGFLSHCGWGSVVEGMVFGVPIIGVPMAYEQPSNAKVV 379          
The following BLAST results are available for this feature:
BLAST of DC900341 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
FLRT_CITMA7.713e-1334.68Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltran... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900341 VSS Citrus sinensis cDNA clone VS28692 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900341 ID=DC900341|Name=DC900341|organism=Citrus sinensis|type=EST|length=1583bp
CTCATATCCTGATCTTTCCTCTCCCATGCCAAAGCCATATGAATTCCATG
CTCAAGCTTGCCGAGATTTTCGGCTTAGCTGGCCTCAAAGTGACCTTCCT
AAACTCCAAGCACAACCACGAACGCCTCATCCGGTACACGGATATCCATG
ANCGTTTTCTGCAGTATTCTGAATTCCAATTTAAGACCATCTCAGATGGT
CTTCCAGCGGATCACCCACGAGCAGGTGACCAATTGATGGAGATGTTCGA
TTCTTTGAGTTTGAATACCAGGCCACTTCTCAAACAGATGCTGATTGACA
CTAGCCCGCCAGTGAGCTGCATCATTGGAGATGCATGTATGGAATTTGTG
GTAGACGTTGCTACTGAACTTGAAATCCCTGTAATCCATTTTCGTGCTAT
AAGTGCTTGTAGCTTCTGGGCATATTTCTCTATCCCTGAAATGATCCAAG
CAGGCGAGCTTCCTATGAAAGCCTACGATGAAGACACGGATCGTCTGATA
ACAAAAGTTCCAGGCATGGAAACTTTTCTGAGATTCCGAGATCTCCCCAG
CTTTTGCCGAGTGAGTGACGTAACCGACCGAGATTTGCAAGTTCTTAAGA
ACGCGACCCAACAGTCCCCTCGAGCCCATGCTTTGATACTCAACACGTTT
GAAGACCTAGAAGAACCAATTCTGTCACATATACGCACCAATGNCCCAAA
GTGTACACAATAGGACCTCTTCACTTGCAGCTCAAGACAGGATTCGCCTC
AACATGATCTCATCGNCATTTCAAAGTCTCCAACAGTCTNTGGGAAGNGG
ACAGAAGTTGCATTGAATGGCTTGGTAAAAGCCTGGGCGGGCTGTACTGT
ACGTAAGCTTTGGTAGCATTACACTGTTGAAAANAGANCAGCTGATTGAG
TTTTGGCACGGTCTTGTAGACAGTAAGCAGCGGTTCTTGTGGGTCATTAG
GCCAGATTCTGTGATTGGCGAAGGTGACGCCCTGGCAGAGCTTGTGGAGG
GCACGAAGGAGAGAGGTCTTTTGGTTAGTTGGGTTCCACAGGAGGAGGTA
CTGGCTCACCAGGCTGTGGCTGGATTCTTGACACACAGCGGCTGGAACTC
AACCTTGGAGAGTATAGTAGCCGGGGTGCCAATGATTTGCTGGCCTTACT
TTGCTGATCAACAGATCAATAGTAGGTTTGTGAGTGAAGTGTGGAATCTT
GGATTGGATATGAAGGATGTGTGCGATAGAAATGTTGTTGAGAAAATGGT
GAATGATCTGATGGTGGAGAGGAAGGAGGAGTTTATGAGAGCAGCTGATC
GGATGGCTACAATGGCTAGAACCACTGCTAATGAAGGTGGACCATCTTAC
TGTAATTTGGACCGTCTGATTGATGATATTAAGATGATGAGCTCCCAAGC
ATGAAAACATATAGCTAAGGTTAGTGCAAGATGTTACTGCTAGATTAAAT
AAATTTTAAAGTTTAGAGATTCTTATCAATAAAAATTAATGTTATATGTA
CATCTGTCTTGATGACTGCTAGTACGCTACTACTAGATTATCTATTGGGA
ATGGCTGCGCTTGGCATTTTGTTAAAAAGTCAT
back to top