DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BRUMB (60 kDa chaperonin OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGG                N DQ+ G+ I++ A++ P   I             K+LE  +   GY+ A GEY D++  GI+DP+KV+RTAL +AASV+ L+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKG-VNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BRUC2 (60 kDa chaperonin OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGG                N DQ+ G+ I++ A++ P   I             K+LE  +   GY+ A GEY D++  GI+DP+KV+RTAL +AASV+ L+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKG-VNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BRUAB (60 kDa chaperonin OS=Brucella abortus GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGG                N DQ+ G+ I++ A++ P   I             K+LE  +   GY+ A GEY D++  GI+DP+KV+RTAL +AASV+ L+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKG-VNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BRUA2 (60 kDa chaperonin OS=Brucella abortus (strain 2308) GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGG                N DQ+ G+ I++ A++ P   I             K+LE  +   GY+ A GEY D++  GI+DP+KV+RTAL +AASV+ L+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKG-VNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BRUA1 (60 kDa chaperonin OS=Brucella abortus (strain S19) GN=groL PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGG                N DQ+ G+ I++ A++ P   I             K+LE  +   GY+ A GEY D++  GI+DP+KV+RTAL +AASV+ L+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKG-VNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_AGRVS (60 kDa chaperonin OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 125/239 (52.30%), Postives = 175/239 (73.22%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KK++I+K++T I+DGAG K  IE R  QI++ IE ++SDYD+EKLQERLAKL+GGVAV+++GG++E EV E+KDR+ DALNAT+AAV+EGIVPGGG                N DQ+ G+ I++ AL++ V  I             K+L++DN + GY+A  GE+ DM+  GI+DP+KV+RTAL +AASV+SL+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGTVISEDLGIKLETVTLDMLGRAKKISITKENTTIVDGAGQKSDIEGRVAQIKAQIEETSSDYDREKLQERLAKLAGGVAVIRVGGSTEIEVKERKDRIDDALNATRAAVQEGIVPGGGTALLRSSTKITVKG-VNDDQEAGINIVRRALQSLVRQIATNAGDEASIIVGKILDKDNDNYGYNAQTGEFGDMIAMGIVDPVKVVRTALQNAASVASLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_OCHA4 (60 kDa chaperonin OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=groL PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 6.495e-65
Identity = 126/239 (52.72%), Postives = 170/239 (71.13%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE ++SDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGG                N DQ+ G+ I++ AL+ P   I             K+LE  +   GY+ A GE+ D++K+G++DP+KV+RTAL +AASV+ L+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLETVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVSQIKQQIEETSSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALLRASAKISAKG-INADQEAGINIVRRALQAPARQITTNAGEEASVIVGKILENASETYGYNTANGEFGDLIKAGVVDPVKVVRTALQNAASVAGLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH603_BRAJA (60 kDa chaperonin 3 OS=Bradyrhizobium japonicum GN=groL3 PE=1 SV=2)

HSP 1 Score: 248.054 bits (632), Expect = 6.495e-65
Identity = 128/244 (52.46%), Postives = 168/244 (68.85%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG  I+E+LG+ LE V L+MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGIVPGGGV             T N DQK GV+I++ AL  P   I             K+L+ +    G+DA  GEY ++V  GIIDP KV+R A+ +A+SV+ L+ TTEA+V ELPK+    P
Sbjct:  290 QDIAILTGGQAISEDLGIKLENVTLNMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKGLRTENDDQKTGVEIVRKALSWPARQIAINAGEDGSIVVGKVLDNEQYSFGFDAQTGEYSNLVSKGIIDPAKVVRIAVQNASSVAGLLITTEAMVAELPKKATAGP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_ROSDO (60 kDa chaperonin 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=groL2 PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 6.495e-65
Identity = 126/244 (51.64%), Postives = 169/244 (69.26%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG +I+E+LGM LE V +DMLG+ KK+ I+KD+T I+DGAG+K  IE R  QIR+ IE +TSDYD+EKLQER+AKL+GGVAV+++GG +E EV E+KDRV DALNAT+AAV+EGIV GGGV            +  N DQ +G+ I++ AL+ P+  I             K+ E D+   G++A   EY DM   G+IDP KV+RTAL DAAS++ L+ TTEA+V + P +   AP
Sbjct:  290 QDIAILTGGQVISEDLGMKLESVTMDMLGSAKKIQITKDETTIVDGAGEKAEIEARVAQIRTQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIVVGGGVALVQAGKHLEGLTGDNNDQNVGISIVRKALEAPLRQIAENAGVDGSVVAGKIRESDDLKFGFNAQTEEYGDMFAFGVIDPAKVVRTALQDAASIAGLLITTEAMVADRPAKEGAAP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_RHOPB (60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=groL2 PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 6.495e-65
Identity = 128/243 (52.67%), Postives = 167/243 (68.72%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +DLA+LTGG LI+++LGM LE V L MLG  KK+ I K++T I+ GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAV+EGIVPGGGV            S  N D + G+ I+  AL+ P+  I             K+LE  +   G+DA   EYVDM+  GI+DP KV+RTAL DA+SV++L+ TTE +V E+P++   A
Sbjct:  290 EDLAILTGGQLISDDLGMKLENVTLKMLGRAKKLVIDKENTTIVGGAGKKADIETRVGQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVEDALNATRAAVQEGIVPGGGVALLRAKKAVGRISNDNPDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKSETFGFDAQTEEYVDMLAKGIVDPAKVVRTALQDASSVAALLVTTECMVAEMPRDAAPA 532          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_BRUMB4.973e-6553.1460 kDa chaperonin OS=Brucella melitensis biotype 2... [more]
CH60_BRUC24.973e-6553.1460 kDa chaperonin OS=Brucella canis (strain ATCC 2... [more]
CH60_BRUAB4.973e-6553.1460 kDa chaperonin OS=Brucella abortus GN=groL PE=3... [more]
CH60_BRUA24.973e-6553.1460 kDa chaperonin OS=Brucella abortus (strain 2308... [more]
CH60_BRUA14.973e-6553.1460 kDa chaperonin OS=Brucella abortus (strain S19)... [more]
CH60_AGRVS4.973e-6552.3060 kDa chaperonin OS=Agrobacterium vitis (strain S... [more]
CH60_OCHA46.495e-6552.7260 kDa chaperonin OS=Ochrobactrum anthropi (strain... [more]
CH603_BRAJA6.495e-6552.4660 kDa chaperonin 3 OS=Bradyrhizobium japonicum GN... [more]
CH602_ROSDO6.495e-6551.6460 kDa chaperonin 2 OS=Roseobacter denitrificans (... [more]
CH602_RHOPB6.495e-6552.6760 kDa chaperonin 2 OS=Rhodopseudomonas palustris ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313; Name=DC900313; organism=Citrus sinensis; type=EST; length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top