DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RICRO (60 kDa chaperonin OS=Rickettsia rickettsii (strain Iowa) GN=groL PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.817e-68
Identity = 136/242 (56.20%), Postives = 175/242 (72.31%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKE 727
            +D+A+LT G+LITE+LGM LE V++  LGT K+VTISK++TVI+DG GDKK+IE+R  QI+S I  +TSDYDKEKLQERLAKLSGGVAVLK+GGA+E EV E+KDRV DAL AT+AAVEEG+V GGGV               N DQ+ G++I+  ALK P+  I             KLLE  + + G++A   +YVDM+K+GIIDP KV+RTAL DAASV+SL+ TTE ++V+ P +  E
Sbjct:  290 EDIAILTKGELITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLLHASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKAE 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RICPU (60 kDa chaperonin OS=Rickettsia peacockii (strain Rustic) GN=groL PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.817e-68
Identity = 136/242 (56.20%), Postives = 175/242 (72.31%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKE 727
            +D+A+LT G+LITE+LGM LE V++  LGT K+VTISK++TVI+DG GDKK+IE+R  QI+S I  +TSDYDKEKLQERLAKLSGGVAVLK+GGA+E EV E+KDRV DAL AT+AAVEEG+V GGGV               N DQ+ G++I+  ALK P+  I             KLLE  + + G++A   +YVDM+K+GIIDP KV+RTAL DAASV+SL+ TTE ++V+ P +  E
Sbjct:  290 EDIAILTKGELITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLLHASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKAE 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_BRAJA (60 kDa chaperonin 1 OS=Bradyrhizobium japonicum GN=groL1 PE=2 SV=3)

HSP 1 Score: 259.225 bits (661), Expect = 2.817e-68
Identity = 131/244 (53.69%), Postives = 173/244 (70.90%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG  I+E+LG+ LE V L MLG  KKV I K++T I++GAG KK IE R  QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGI+PGGGV             T N DQK GV I++ A++ P   I             KLLE  + + G++AA GEY D+ K+G+IDP KV+RTAL DAASV++L+ TTEA++ E PK+ + AP
Sbjct:  290 EDIAILTGGQAISEDLGIKLENVTLKMLGRAKKVVIDKENTTIVNGAGSKKDIEARVTQIKMQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALLRGLKALDAIKTVNADQKAGVDIVRRAIQVPARQIVQNAGEDGSLVVGKLLENSSYNWGFNAASGEYQDLAKAGVIDPAKVVRTALQDAASVAALLITTEALIAEKPKKSEPAP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RICFE (60 kDa chaperonin OS=Rickettsia felis GN=groL PE=3 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 3.680e-68
Identity = 135/243 (55.56%), Postives = 177/243 (72.84%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +D+A+LT G+LITE+LGM LE V++  LGT K+VTISK++TVI+DG GDKK+IE+R  QI+S I  +TSDYDKEKLQERLAKLSGGVAVLK+GGA+E EV E+KDRV DAL AT+AAVEEG+V GGGV               N DQ+ G++I+  ALK P+  I             KLLE  + + G++A   +YVDM+K+GIIDP KV+RTAL DAASV+SL+ TTE ++V+ P + +++
Sbjct:  289 EDIAILTKGELITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLLHASQTLRNLKVDNKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKEDS 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RICAE (60 kDa chaperonin OS=Rickettsia africae (strain ESF-5) GN=groL PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 8.197e-68
Identity = 135/242 (55.79%), Postives = 174/242 (71.90%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKE 727
            +D+A+LT G+LITE+LGM LE V++  LGT K+VTISK++TVI+DG GDKK+IE+R  QI+S I  +TSDYDKEKLQERLAKLSGGVAVLK+GGA+E EV E+KDRV DAL AT+AAVEEG+V GGGV               N DQ+ G++I+  ALK P+  I             KLLE  + + G++A   +YVDM+K+GIIDP KV+RTAL DA SV+SL+ TTE ++V+ P +  E
Sbjct:  290 EDIAILTKGELITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLLHASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDATSVASLIITTETLIVDEPSDKAE 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_RHIEC (60 kDa chaperonin 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL1 PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 8.197e-68
Identity = 134/244 (54.92%), Postives = 177/244 (72.54%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DG+G K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDR+ DALNAT+AAV+EGIVPGGGV               N DQ+ G+ I++ AL+ P   I             K+L++D  + GY+A  GEY DM+  GIIDP+KV+RTAL DAASV+SL+ TTEA++ ELPK  K+AP
Sbjct:  290 EDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALLRSSVKISAKG-VNDDQEAGINIVRRALQAPARQIAENAGDEASIVVGKILDKDQDNYGYNAQTGEYGDMIGMGIIDPVKVVRTALQDAASVASLLITTEAMIAELPK--KDAP 530          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_BRASO (60 kDa chaperonin 2 OS=Bradyrhizobium sp. (strain ORS278) GN=groL2 PE=3 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 1.071e-67
Identity = 132/244 (54.10%), Postives = 172/244 (70.49%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG  I+E+LG+ LE VNL MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGI+PGGGV             T N DQK GV+I++ AL  P   I             K+LE++    G+D+  G+YV+MV  GIIDP KV+RTA+ +AASV+SL+ TTEA+V ELPK+    P
Sbjct:  290 QDIAILTGGQAISEDLGIKLENVNLSMLGRAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALLRASEQLKGVRTKNEDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILEKEQYAYGFDSQSGDYVNMVSKGIIDPTKVVRTAIQNAASVASLLITTEAMVAELPKKAAAGP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RICM5 (60 kDa chaperonin OS=Rickettsia massiliae (strain Mtu5) GN=groL PE=3 SV=2)

HSP 1 Score: 256.914 bits (655), Expect = 1.398e-67
Identity = 135/242 (55.79%), Postives = 175/242 (72.31%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKE 727
            +D+A+LT G+LITE+LGM LE V++  LGT K+VTISK++TVI+DG GDKK+IE+R  QI+S I  +TSDYDKEKLQERLAKLSGGVAVLK+GGA+E EV E+KDRV DAL AT+AAVEEG+V GGGV               N DQ+ G++I+  ALK P+  I             KLLE  + + G++A   +YVDM+K+GIIDP KV+RTAL DAASV+SL+ TTE ++V+   + +E
Sbjct:  290 EDIAILTKGELITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLLHASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDESSDKEE 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BEII9 (60 kDa chaperonin OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=groL PE=3 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.398e-67
Identity = 135/244 (55.33%), Postives = 170/244 (69.67%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG LI+EELG+ LE V L MLG  K++ I K+ T I+DGAG+K  IE R  QI++ I  +TSDYD+EK+QERLAKL+GGVAVL++GG++E EV EKKDRV DALNAT+AAVEEG+ PGGGV             T N DQK G++I++ A++TP   I             KLLE +    GY+A  GEY DMVK GIIDP KV+RTAL DAAS++ L+ TTEA + E PK  KEAP
Sbjct:  290 EDIAILTGGTLISEELGIKLENVTLAMLGRAKRIRIDKEATTIIDGAGNKDDIEGRISQIKAQIAETTSDYDREKMQERLAKLAGGVAVLRVGGSTEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALLRAIKALENLPTDNSDQKAGIEIVRKAIQTPAKQIVDNSGGDGAVVVGKLLESNEYAFGYNAQTGEYGDMVKLGIIDPTKVVRTALQDAASIAGLLITTEATITEAPK--KEAP 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH603_NITWN (60 kDa chaperonin 3 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL3 PE=3 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.398e-67
Identity = 134/243 (55.14%), Postives = 168/243 (69.14%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            +D+A+LT G LI++ELGM LE V L+MLG  KKV I K++T I++GAG KK IE R  QIR+ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIVPGGG             +  N D + G+ I+  AL+ P+  I             K+LE      G+DA K EYVDMV  GIIDP KV+RTAL DA+S++ L+ TTEA+V ELPK+   A
Sbjct:  290 EDIAILTSGQLISDELGMKLENVTLNMLGRAKKVLIDKENTTIVNGAGKKKDIEARVGQIRARIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRVEDALNATRAAVEEGIVPGGGTALLRARKAVGRINNDNSDVQAGINIVLKALEAPIRQIAENAGVEGSIVVGKILENKTETFGFDAQKEEYVDMVAKGIIDPAKVVRTALQDASSIAGLLVTTEAMVAELPKDEPPA 532          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_RICRO2.817e-6856.2060 kDa chaperonin OS=Rickettsia rickettsii (strain... [more]
CH60_RICPU2.817e-6856.2060 kDa chaperonin OS=Rickettsia peacockii (strain ... [more]
CH601_BRAJA2.817e-6853.6960 kDa chaperonin 1 OS=Bradyrhizobium japonicum GN... [more]
CH60_RICFE3.680e-6855.5660 kDa chaperonin OS=Rickettsia felis GN=groL PE=3... [more]
CH60_RICAE8.197e-6855.7960 kDa chaperonin OS=Rickettsia africae (strain ES... [more]
CH601_RHIEC8.197e-6854.9260 kDa chaperonin 1 OS=Rhizobium etli (strain CFN ... [more]
CH602_BRASO1.071e-6754.1060 kDa chaperonin 2 OS=Bradyrhizobium sp. (strain ... [more]
CH60_RICM51.398e-6755.7960 kDa chaperonin OS=Rickettsia massiliae (strain ... [more]
CH60_BEII91.398e-6755.3360 kDa chaperonin OS=Beijerinckia indica subsp. in... [more]
CH603_NITWN1.398e-6755.1460 kDa chaperonin 3 OS=Nitrobacter winogradskyi (s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top