DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_PORG3 (60 kDa chaperonin OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=groL PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 111/244 (45.49%), Postives = 161/244 (65.98%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+EE G+ LE   +DMLGT +KVT+ KD+T I++GAG+K+ I  R  QI++ IEN+TSDYD+EKLQERLAKL+GGVAVL +G ASE E+ EKKDRV DAL+AT+AA+EEG VPGGG                N D+  G++I++ A++ P+  I             K +++   D GY+A    + ++  +G+IDP KV R AL +AAS++ +  TTE ++ +  ++   AP
Sbjct:  290 EDIAILTGGTVISEETGLKLENATMDMLGTAEKVTVDKDNTTIVNGAGNKEGIASRITQIKAQIENTTSDYDREKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVEDALSATRAAIEEGTVPGGGTAYIRAIAALEGLKGENEDETTGIEIVKRAIEEPLRQIVANAGKEGAVVVQK-VKEGKDDFGYNARTDVFENLYSTGVIDPAKVTRVALENAASIAGMFLTTECVIADKKEDNPAAP 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_PARD8 (60 kDa chaperonin OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=groL PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 113/244 (46.31%), Postives = 162/244 (66.39%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+AVLTGG +I+EE G+ LE   +DMLGT +K+T+ KD T I++GAGDK++I+ R  QI+  +EN+TSDYDKEKLQERLAK++GGVAVL +G  SE E+ EKKDRV DAL+AT+AA+EEG VPGGGV               N D+  G++I++ A++ P+  I             K +++   D GY+A K  + ++ ++G+IDP KV R AL +AAS++ +  TTE ++ E  +E    P
Sbjct:  290 EDIAVLTGGTVISEEKGLKLEGATMDMLGTAEKITVDKDTTTIVNGAGDKEAIQARIGQIKIQMENTTSDYDKEKLQERLAKMAGGVAVLYVGAPSEVEMKEKKDRVDDALHATRAAIEEGTVPGGGVAYIRAIDALEGMKGDNEDETTGIEIVKRAIEEPLRQIVANAGKEGAVIVQK-VKEGKGDFGYNARKDCFENLCEAGVIDPAKVTRVALENAASIAGMFLTTECVIAEKKEETPAMP 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_METI4 (60 kDa chaperonin OS=Methylacidiphilum infernorum (isolate V4) GN=groL PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 115/242 (47.52%), Postives = 164/242 (67.77%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKE 727
            +D+A+LTGG  +TE+LG+ LE V L+ LG  K++ + K++T I++G+G +  I+ R  QIR  IE +TSDYD+EKLQERLAKL+GGVAV+ +G A+E E+ EKK RV DAL+AT+AAVEEGIVPGGGV            S    D++IG  I+  AL+ P+ T+             ++  +   + G+D AK  YVDM ++GI+DP KV RTAL +AAS++ L+ TTEA+V E+P++ K+
Sbjct:  290 EDIAILTGGRCLTEDLGIKLENVQLEDLGRAKRIIVEKENTTIIEGSGSRSEIQGRINQIRRQIEETTSDYDREKLQERLAKLAGGVAVIHVGAATETELKEKKARVEDALHATRAAVEEGIVPGGGVALLRCQKAIEGLSLKG-DEQIGANIVYKALEYPLKTLADNAGLEGSVIVNEVKAKKGNE-GFDVAKRSYVDMFEAGIVDPTKVTRTALENAASIAGLLLTTEAMVTEIPEKEKK 529          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_LEGPN (60 kDa chaperonin OS=Legionella pneumophila GN=groL PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 116/239 (48.54%), Postives = 162/239 (67.78%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LT G +I+EE+G  LE   L+ LG+ K++ ++K++T I+DG G    I  R  QIR+ +E +TSDYD+EKLQER+AKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEGIV GGGV               N DQ +G+ I++ A+++P+  I             K+ E  + + G++AA GEY DMV+ GI+DP KV R AL +AASV+SLM TTE +V +LPK+
Sbjct:  289 QDIAILTKGQVISEEIGKSLEGATLEDLGSAKRIVVTKENTTIIDGEGKATEINARIAQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALIRAQKALDSLKGDNDDQNMGINILRRAIESPMRQIVTNAGYEASVVVNKVAEHKD-NYGFNAATGEYGDMVEMGILDPTKVTRMALQNAASVASLMLTTECMVADLPKK 526          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_LEGPL (60 kDa chaperonin OS=Legionella pneumophila (strain Lens) GN=groL PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 116/239 (48.54%), Postives = 162/239 (67.78%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LT G +I+EE+G  LE   L+ LG+ K++ ++K++T I+DG G    I  R  QIR+ +E +TSDYD+EKLQER+AKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEGIV GGGV               N DQ +G+ I++ A+++P+  I             K+ E  + + G++AA GEY DMV+ GI+DP KV R AL +AASV+SLM TTE +V +LPK+
Sbjct:  289 QDIAILTKGQVISEEIGKSLEGATLEDLGSAKRIVVTKENTTIIDGEGKATEINARITQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALIRAQKALDSLKGDNDDQNMGINILRRAIESPMRQIVTNAGYEASVVVNKVAEHKD-NYGFNAATGEYGDMVEMGILDPTKVTRMALQNAASVASLMLTTECMVADLPKK 526          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_LEGPH (60 kDa chaperonin OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=groL PE=3 SV=2)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 116/239 (48.54%), Postives = 162/239 (67.78%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LT G +I+EE+G  LE   L+ LG+ K++ ++K++T I+DG G    I  R  QIR+ +E +TSDYD+EKLQER+AKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEGIV GGGV               N DQ +G+ I++ A+++P+  I             K+ E  + + G++AA GEY DMV+ GI+DP KV R AL +AASV+SLM TTE +V +LPK+
Sbjct:  289 QDIAILTKGQVISEEIGKSLEGATLEDLGSAKRIVVTKENTTIIDGEGKATEINARITQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALIRAQKALDSLKGDNDDQNMGINILRRAIESPMRQIVTNAGYEASVVVNKVAEHKD-NYGFNAATGEYGDMVEMGILDPTKVTRMALQNAASVASLMLTTECMVADLPKK 526          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_LEGPA (60 kDa chaperonin OS=Legionella pneumophila (strain Paris) GN=groL PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 116/239 (48.54%), Postives = 162/239 (67.78%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LT G +I+EE+G  LE   L+ LG+ K++ ++K++T I+DG G    I  R  QIR+ +E +TSDYD+EKLQER+AKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEGIV GGGV               N DQ +G+ I++ A+++P+  I             K+ E  + + G++AA GEY DMV+ GI+DP KV R AL +AASV+SLM TTE +V +LPK+
Sbjct:  289 QDIAILTKGQVISEEIGKSLEGATLEDLGSAKRIVVTKENTTIIDGEGKATEINARIAQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALIRAQKALDSLKGDNDDQNMGINILRRAIESPMRQIVTNAGYEASVVVNKVAEHKD-NYGFNAATGEYGDMVEMGILDPTKVTRMALQNAASVASLMLTTECMVADLPKK 526          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_KLEP7 (60 kDa chaperonin OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=groL PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 117/238 (49.16%), Postives = 159/238 (66.81%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPK 715
            QD+A LTGG +I+EE+GM+LEK  L+ LG  K+V I+KD T I+DG G++ +I+ R  QIR  IE +TSDYD+EKLQER+AKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEG+V GGGV            +  N DQ +G+++   A++ P+  I              +   D  + GY+AA  EY +M+  GI+DP KV R+AL  AASV+ LM TTE +V +LPK
Sbjct:  290 QDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEESAIQGRVAQIRKQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVDDALHATRAAVEEGVVAGGGVALVRVAAKLAGLTGQNEDQNVGIKVALRAMEAPLRQIVSNAGEEPSVVANNVKAGDG-NYGYNAATEEYGNMIDFGILDPTKVTRSALQYAASVAGLMITTECMVTDLPK 526          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_KLEP3 (60 kDa chaperonin OS=Klebsiella pneumoniae (strain 342) GN=groL PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 117/238 (49.16%), Postives = 159/238 (66.81%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPK 715
            QD+A LTGG +I+EE+GM+LEK  L+ LG  K+V I+KD T I+DG G++ +I+ R  QIR  IE +TSDYD+EKLQER+AKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEG+V GGGV            +  N DQ +G+++   A++ P+  I              +   D  + GY+AA  EY +M+  GI+DP KV R+AL  AASV+ LM TTE +V +LPK
Sbjct:  290 QDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEESAIQGRVAQIRKQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVDDALHATRAAVEEGVVAGGGVALVRVAAKLAGLTGQNEDQNVGIKVALRAMEAPLRQIVSNAGEEPSVVANNVKAGDG-NYGYNAATEEYGNMIDFGILDPTKVTRSALQYAASVAGLMITTECMVTDLPK 526          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_HELPS (60 kDa chaperonin OS=Helicobacter pylori (strain Shi470) GN=groL PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.450e-56
Identity = 123/244 (50.41%), Postives = 162/244 (66.39%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+AVLTGG +I+EELG+ LE   ++ LG   ++ I KD+T I+DG G    +++R  QI++ I ++TSDYDKEKLQERLAKLSGGVAV+K+G ASE E+ EKKDRV DAL+ATKAAVEEGIV GGG                + D+K+G +II  A+K P+  I             ++ + +    G++A+ G+YVDM K GIIDPLKV R AL +A SVSSL+ TTEA V E+ KE K  P
Sbjct:  289 KDIAVLTGGQVISEELGLTLENAEVEFLGKAGRIVIDKDNTTIVDGKGHSHDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVHL--NLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVQKHEG-HFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEI-KEEKATP 528          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_PORG31.450e-5645.4960 kDa chaperonin OS=Porphyromonas gingivalis (str... [more]
CH60_PARD81.450e-5646.3160 kDa chaperonin OS=Parabacteroides distasonis (s... [more]
CH60_METI41.450e-5647.5260 kDa chaperonin OS=Methylacidiphilum infernorum ... [more]
CH60_LEGPN1.450e-5648.5460 kDa chaperonin OS=Legionella pneumophila GN=gro... [more]
CH60_LEGPL1.450e-5648.5460 kDa chaperonin OS=Legionella pneumophila (strai... [more]
CH60_LEGPH1.450e-5648.5460 kDa chaperonin OS=Legionella pneumophila subsp.... [more]
CH60_LEGPA1.450e-5648.5460 kDa chaperonin OS=Legionella pneumophila (strai... [more]
CH60_KLEP71.450e-5649.1660 kDa chaperonin OS=Klebsiella pneumoniae subsp. ... [more]
CH60_KLEP31.450e-5649.1660 kDa chaperonin OS=Klebsiella pneumoniae (strain... [more]
CH60_HELPS1.450e-5650.4160 kDa chaperonin OS=Helicobacter pylori (strain S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top