DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_COXBU (60 kDa chaperonin OS=Coxiella burnetii GN=groL PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 3.444e-66
Identity = 129/243 (53.09%), Postives = 171/243 (70.37%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            QD+AVLTGG +I+EE+G+ LE  +LD LG+ K+V ++KDDT I+DG+GD   I+ R EQIR  IENS+SDYDKEKLQERLAKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEG+VPGGGV               N DQ++GV+I + A+  P+  I             K+L   + + GY+AA GEY DM++ GI+DP KV RTAL +AAS++ LM TTE +V E PK+ +E+
Sbjct:  290 QDIAVLTGGKVISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRVLKSLDSVEVENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEES 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_COXBR (60 kDa chaperonin OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=groL PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 3.444e-66
Identity = 129/243 (53.09%), Postives = 171/243 (70.37%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            QD+AVLTGG +I+EE+G+ LE  +LD LG+ K+V ++KDDT I+DG+GD   I+ R EQIR  IENS+SDYDKEKLQERLAKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEG+VPGGGV               N DQ++GV+I + A+  P+  I             K+L   + + GY+AA GEY DM++ GI+DP KV RTAL +AAS++ LM TTE +V E PK+ +E+
Sbjct:  290 QDIAVLTGGKVISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRVLKSLDSVEVENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEES 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_COXBN (60 kDa chaperonin OS=Coxiella burnetii (strain Dugway 5J108-111) GN=groL PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 3.444e-66
Identity = 129/243 (53.09%), Postives = 171/243 (70.37%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            QD+AVLTGG +I+EE+G+ LE  +LD LG+ K+V ++KDDT I+DG+GD   I+ R EQIR  IENS+SDYDKEKLQERLAKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEG+VPGGGV               N DQ++GV+I + A+  P+  I             K+L   + + GY+AA GEY DM++ GI+DP KV RTAL +AAS++ LM TTE +V E PK+ +E+
Sbjct:  290 QDIAVLTGGKVISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRVLKSLDSVEVENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEES 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_COXB2 (60 kDa chaperonin OS=Coxiella burnetii (strain CbuG_Q212) GN=groL PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 3.444e-66
Identity = 129/243 (53.09%), Postives = 171/243 (70.37%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            QD+AVLTGG +I+EE+G+ LE  +LD LG+ K+V ++KDDT I+DG+GD   I+ R EQIR  IENS+SDYDKEKLQERLAKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEG+VPGGGV               N DQ++GV+I + A+  P+  I             K+L   + + GY+AA GEY DM++ GI+DP KV RTAL +AAS++ LM TTE +V E PK+ +E+
Sbjct:  290 QDIAVLTGGKVISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRVLKSLDSVEVENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEES 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_COXB1 (60 kDa chaperonin OS=Coxiella burnetii (strain CbuK_Q154) GN=groL PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 3.444e-66
Identity = 129/243 (53.09%), Postives = 171/243 (70.37%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            QD+AVLTGG +I+EE+G+ LE  +LD LG+ K+V ++KDDT I+DG+GD   I+ R EQIR  IENS+SDYDKEKLQERLAKL+GGVAV+K+G A+E E+ EKK RV DAL+AT+AAVEEG+VPGGGV               N DQ++GV+I + A+  P+  I             K+L   + + GY+AA GEY DM++ GI+DP KV RTAL +AAS++ LM TTE +V E PK+ +E+
Sbjct:  290 QDIAVLTGGKVISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRVLKSLDSVEVENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEES 532          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_BRASB (60 kDa chaperonin 2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL2 PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 3.444e-66
Identity = 127/244 (52.05%), Postives = 170/244 (69.67%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG  I+++LG+ LE V L  LG  +++ I K++T ++ G G KK I+ R  QIR+ IE +TSDYD+EKLQERLAKLSGGVAV+++GGA+E EV EKKDRV DALNAT+AA+ EGIVPGGGV            +  N D + G+QI+  AL+ P+  I             K+LE  +   G+DA K EYVD++++GI+DP KV+RTAL DAASV++L+ TTEA+VVELPKE    P
Sbjct:  290 EDIAILTGGQTISQDLGIKLENVTLSQLGRARRIRIDKENTTVVGGTGKKKDIDARIAQIRAQIEETTSDYDREKLQERLAKLSGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAIAEGIVPGGGVALLRAKAAVSKLTNPNPDIQAGIQIVLKALEAPIRQIADNAGVEGSIVVGKILENRSPTFGFDAQKEEYVDLIEAGIVDPAKVVRTALQDAASVAALIVTTEALVVELPKEKAALP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_RHOPB (60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=groL1 PE=3 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 3.444e-66
Identity = 129/239 (53.97%), Postives = 169/239 (70.71%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LTGG  I+E+LG+ +E V L MLG  KKV I K++T I++GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGI+PGGGV             T N DQK GV+I++ AL  P   I             K+LE+D    G+D+  GEY DMVK GIIDP KV+R A+ +AASV++L+ TTEA++ ELPK+
Sbjct:  290 QDIAILTGGQAISEDLGIKMENVTLAMLGKAKKVMIDKENTTIVNGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGILPGGGVALLRASEQLKRIKTQNDDQKTGVEIVRKALSWPARQIAINAGEDGSVIVGKILEKDQYSYGFDSQSGEYGDMVKKGIIDPTKVVRAAIQNAASVAALLITTEAMIAELPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_CAUCR (60 kDa chaperonin OS=Caulobacter crescentus GN=groL PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 4.498e-66
Identity = 127/244 (52.05%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTG  +++E++G+ LE V+L+MLG  KKV+I+KDDT I+DG G+K  IE R  QI+  IE++TSDYDKEKLQERLAKL+GGVAV+++GG++E EV EKKDRV DALNAT+AA +EGIVPGGG                N DQ  G+ I++ AL+ P+  I             K+LE DN+  G++A   +YVD+V  G+IDP KV+RTAL +AASV+ L+ TTEA +VE PK+   AP
Sbjct:  290 EDIAILTGAQVVSEDIGIKLENVSLEMLGRAKKVSITKDDTTIVDGVGEKADIEARIAQIKRQIEDTTSDYDKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAADEGIVPGGGTALLKASKALAGVVGDNDDQTAGIAIVRRALQAPIRQIAENAGVEGSIVVGKILENDNSAFGFNAQTEQYVDLVVDGVIDPAKVVRTALQNAASVAGLLITTEAAIVEAPKKGGGAP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_CAUCN (60 kDa chaperonin OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=groL PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 4.498e-66
Identity = 127/244 (52.05%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTG  +++E++G+ LE V+L+MLG  KKV+I+KDDT I+DG G+K  IE R  QI+  IE++TSDYDKEKLQERLAKL+GGVAV+++GG++E EV EKKDRV DALNAT+AA +EGIVPGGG                N DQ  G+ I++ AL+ P+  I             K+LE DN+  G++A   +YVD+V  G+IDP KV+RTAL +AASV+ L+ TTEA +VE PK+   AP
Sbjct:  290 EDIAILTGAQVVSEDIGIKLENVSLEMLGRAKKVSITKDDTTIVDGVGEKADIEARIAQIKRQIEDTTSDYDKEKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALNATRAAADEGIVPGGGTALLKASKALAGVVGDNDDQTAGIAIVRRALQAPIRQIAENAGVEGSIVVGKILENDNSAFGFNAQTEQYVDLVVDGVIDPAKVVRTALQNAASVAGLLITTEAAIVEAPKKGGGAP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_AGRT5 (60 kDa chaperonin OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=groL PE=3 SV=2)

HSP 1 Score: 251.906 bits (642), Expect = 4.498e-66
Identity = 129/244 (52.87%), Postives = 176/244 (72.13%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDR+ DALNAT+AAV+EGIVPGGGV               N DQ+ G+ I++ AL++ V  I             K+L+++  + GY+A  GEY D++  GI+DP+KV+RTAL +AASV+SL+ TTEA++ ELPK+    P
Sbjct:  290 EDIAILTGGTVISEDLGIKLESVTLDMLGKSKKVSISKENTTIVDGAGQKSDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGVALLRSSTKITVKG-VNDDQEAGINIVRKALQSLVRQIAENAGDEASIVVGKILDKNEDNYGYNAQTGEYGDLIALGIVDPVKVVRTALQNAASVASLLITTEAMIAELPKKESAMP 532          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_COXBU3.444e-6653.0960 kDa chaperonin OS=Coxiella burnetii GN=groL PE=... [more]
CH60_COXBR3.444e-6653.0960 kDa chaperonin OS=Coxiella burnetii (strain RSA... [more]
CH60_COXBN3.444e-6653.0960 kDa chaperonin OS=Coxiella burnetii (strain Dug... [more]
CH60_COXB23.444e-6653.0960 kDa chaperonin OS=Coxiella burnetii (strain Cbu... [more]
CH60_COXB13.444e-6653.0960 kDa chaperonin OS=Coxiella burnetii (strain Cbu... [more]
CH602_BRASB3.444e-6652.0560 kDa chaperonin 2 OS=Bradyrhizobium sp. (strain ... [more]
CH601_RHOPB3.444e-6653.9760 kDa chaperonin 1 OS=Rhodopseudomonas palustris ... [more]
CH60_CAUCR4.498e-6652.0560 kDa chaperonin OS=Caulobacter crescentus GN=gro... [more]
CH60_CAUCN4.498e-6652.0560 kDa chaperonin OS=Caulobacter crescentus (strai... [more]
CH60_AGRT54.498e-6652.8760 kDa chaperonin OS=Agrobacterium tumefaciens (st... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top