DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH603_RHIL3 (60 kDa chaperonin 3 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=groL3 PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 2.915e-65
Identity = 128/244 (52.46%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LT G +I+E+LG+ LE V LDMLG  KKV+I K++T I+DG+G K  IE R  QIR+ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDRV DAL+AT+AAVEEGI+PGGGV             TAN DQ++GV I++ A++ P   I             KL E+     G++A  GEY D+   G+IDP KV+RTAL DAAS++ L+ TTEA++ E P+  K+AP
Sbjct:  290 EDIAILTAGTVISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKSDIEGRVAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDNVETANGDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWNAQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMIAEKPR--KDAP 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_RHIEC (60 kDa chaperonin 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL2 PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 2.915e-65
Identity = 126/239 (52.72%), Postives = 169/239 (70.71%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LT G +I+E+LG+ LE V L+MLG  KKV I K++T I+DGAG K  ++ R  QIR+ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDRV DAL+AT+AAVEEGI+PGGGV             TAN DQ++GV I++ A++ PV  I             KL E+ +   G++A  GEY D+   G+IDP KV+RTAL DAASV+ L+ TTEA++ E PK+
Sbjct:  290 EDIAILTAGTVISEDLGIKLENVTLNMLGRAKKVAIEKENTTIIDGAGSKAELDGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDSIKTANDDQRVGVDIVRRAIEAPVRQIAENAGAEGSIIVGKLREKSDFSYGWNAQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_BRAJA (60 kDa chaperonin 2 OS=Bradyrhizobium japonicum GN=groL2 PE=2 SV=2)

HSP 1 Score: 249.21 bits (635), Expect = 2.915e-65
Identity = 128/239 (53.56%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            QD+A+LTGG  I+E+LG+ LE V L+MLG  KKV I K++T I+ GAG K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV E+KDRV DA++AT+AAVEEGI+PGGGV             T N DQK GV+I++ AL  P   I             K+LE+D    GYD+  GEY ++V  GIIDP KV+R A+ +AASV++L+ TTEA+V E+PK+
Sbjct:  290 QDIAILTGGQAISEDLGIKLENVTLNMLGRAKKVMIDKENTTIVSGAGKKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALLRASEHLKGIRTKNDDQKTGVEIVRKALSYPARQIAINAGEDGSVIVGKILEKDQYSYGYDSQTGEYGNLVSKGIIDPTKVVRVAIQNAASVAALLITTEAMVAEVPKK 528          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_HYDS0 (60 kDa chaperonin OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=groL PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 3.808e-65
Identity = 125/244 (51.23%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG  ITE+LG+ LE V LDMLG  +KV + K++T I+ G GDKK +E R EQI+  I+ +TSDYD+EKLQERLAKLSGGVA++++G A+E+E+ EKK RV DA++ATKAA EEGIV GGG             ++AN D+++GV+I+ NA K P+  I             K+ E  + + G+DAA GEY DMVK+GIIDP KV+RTAL +AAS +  M T EA++ ELP++ ++ P
Sbjct:  290 EDIAILTGGQAITEDLGIKLESVTLDMLGQAEKVIVDKENTTIVGGKGDKKKVEARIEQIKKQIKETTSDYDREKLQERLAKLSGGVAIIRVGAATESELKEKKARVEDAVHATKAAAEEGIVAGGGTALAKASRVLENYTSANKDRELGVKIVYNACKYPLKQIAYNAGYEGSLVLEKVYEDQDKNYGFDAANGEYKDMVKAGIIDPTKVVRTALQNAASAAGTMLTAEALIAELPEKKEKTP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_RHILE (60 kDa chaperonin 2 OS=Rhizobium leguminosarum GN=groL2 PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 3.808e-65
Identity = 128/244 (52.46%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LT G +I+E+LG+ LE V LDMLG  KKV+I K++T I+DG+G K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDRV DAL+AT+AAVEEGI+PGGGV             TAN DQ++GV I++ A++ P   I             KL E+     G++A  GEY D+   G+IDP KV+RTAL DAAS++ L+ TTEA++ E PK  K+AP
Sbjct:  290 EDIAILTAGTVISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDAVKTANGDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWNAQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMIAEKPK--KDAP 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_SILPO (60 kDa chaperonin OS=Silicibacter pomeroyi GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/244 (52.05%), Postives = 171/244 (70.08%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG +I+E+LGM LE V +DMLGT KK++I+KD+T I+DGAG+K  IE R  QIR+ IE +TSDYD+EKLQER+AKL+GGVAV+++GG +E EV E+KDRV DALNAT+AAV+EG+V GGGV              AN DQ  G+ I++ A++ P+  I             K+ E  +   G++A   EY DM K G+IDP KV+RTAL DA+SV+ L+ TTEA+V + P+  K+AP
Sbjct:  290 QDIAILTGGQVISEDLGMKLESVTMDMLGTAKKISITKDETTIVDGAGEKAEIEARVAQIRTQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGVVVGGGVALVQAGKVLADLEGANADQTAGINIVRKAIEAPLRQIAENAGVDGAVVAGKVRESGDASFGFNAQTEEYGDMFKFGVIDPAKVVRTALEDASSVAGLLITTEAMVADKPQ--KDAP 531          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_RHILW (60 kDa chaperonin OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/239 (53.14%), Postives = 175/239 (73.22%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DG+G K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GG++E EV EKKDR+ DALNAT+AAV+EGIVPGGG+              AN DQ+ G+ I++ AL++ V  I             K+L+++  + GY+A   E+ DM+  GI+DPLKV+RTAL +AASV+SL+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDALNATRAAVQEGIVPGGGIALLRSSTKITVKG-ANDDQEAGINIVRRALQSLVRQIAENAGDEASIVVGKVLDKNEDNYGYNAQTSEFGDMIAMGIVDPLKVVRTALQNAASVASLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BRUSU (60 kDa chaperonin OS=Brucella suis GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGG                N DQ+ G+ I++ A++ P   I             K+LE  +   GY+ A GEY D++  GI+DP+KV+RTAL +AASV+ L+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKG-VNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BRUSI (60 kDa chaperonin OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGG                N DQ+ G+ I++ A++ P   I             K+LE  +   GY+ A GEY D++  GI+DP+KV+RTAL +AASV+ L+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKG-VNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPKK 527          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BRUME (60 kDa chaperonin OS=Brucella melitensis GN=groL PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.973e-65
Identity = 127/239 (53.14%), Postives = 168/239 (70.29%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKE 718
            +D+A+LTGG +I+E+LG+ LE V LDMLG  KKV+ISK++T I+DGAG K  I+ R  QI+  IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DALNAT+AAVEEGIV GGG                N DQ+ G+ I++ A++ P   I             K+LE  +   GY+ A GEY D++  GI+DP+KV+RTAL +AASV+ L+ TTEA++ ELPK+
Sbjct:  290 EDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKG-VNADQEAGINIVRRAIQAPARQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAASVAGLLITTEAMIAELPKK 527          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH603_RHIL32.915e-6552.4660 kDa chaperonin 3 OS=Rhizobium leguminosarum bv.... [more]
CH602_RHIEC2.915e-6552.7260 kDa chaperonin 2 OS=Rhizobium etli (strain CFN ... [more]
CH602_BRAJA2.915e-6553.5660 kDa chaperonin 2 OS=Bradyrhizobium japonicum GN... [more]
CH60_HYDS03.808e-6551.2360 kDa chaperonin OS=Hydrogenobaculum sp. (strain ... [more]
CH602_RHILE3.808e-6552.4660 kDa chaperonin 2 OS=Rhizobium leguminosarum GN=... [more]
CH60_SILPO4.973e-6552.0560 kDa chaperonin OS=Silicibacter pomeroyi GN=groL... [more]
CH60_RHILW4.973e-6553.1460 kDa chaperonin OS=Rhizobium leguminosarum bv. t... [more]
CH60_BRUSU4.973e-6553.1460 kDa chaperonin OS=Brucella suis GN=groL PE=3 SV... [more]
CH60_BRUSI4.973e-6553.1460 kDa chaperonin OS=Brucella suis (strain ATCC 23... [more]
CH60_BRUME4.973e-6553.1460 kDa chaperonin OS=Brucella melitensis GN=groL P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top