DC900291

Overview
NameDC900291
Unique NameDC900291
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length991
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900291_ssr1 microsatellite DC900291_ssr1:1..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig906 contig Csv1_Contig906:136..1126. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_MYCLE (6-phosphogluconolactonase OS=Mycobacterium leprae GN=pgl PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 2.188e-30
Identity = 86/249 (34.54%), Postives = 126/249 (50.60%), Query Frame = 1
Query:   85 NVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSL-IDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFP--KFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATSKL 822
            +V++F   + +  +  K  A         +    +VL+GGS  I  LR L        I+W++ H+FW DER VPKD D+ N K A    L  + I    V+ +       G   D E     L    +LA  AA G+P   FD+ L+GMGP+GHI SLFP    ++E  + V  +++SPKPPPERIT T   I  S  + ++V G  K+ AV  A+G   ++  +P   A+  E   W LD+ A +K+
Sbjct:    4 SVEIFSDSKTMVGAAGKRLASTIQSAVAARERALIVLTGGSSGIGLLRDLATRG--QQIDWSRVHLFWGDERYVPKDDDERNEKQARVALLDHIDIPPSQVHPMPAGDGEFG--NDLEAAA--LAYEQLLAAYAAPGYPTPNFDVHLMGMGPEGHINSLFPNTVAVRETSRMVVGVRNSPKPPPERITLTLNAIQRSREVWLMVSGTAKADAVAAAMGGAPSAS-IPAAGAVGLETTLWLLDEEAAAKI 245          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: SOL3_YEAST (6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae GN=SOL3 PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 1.568e-28
Identity = 87/254 (34.25%), Postives = 130/254 (51.18%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSL-RKLVEPPYVDS-IEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTG-NVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPK-FDLMLLGMGPDGHIASLFPGHP---LLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMA--LAEEEFTWFLDKXATSKL 822
            V VF     L   L ++      +  ++K  F V +SGGSLID+L   LV    + S ++W+KW +++ DER+VP    DSNY       L ++P T+  NVY ++++L    A  +           N +A       P+  DL+LLG GPDGH  SLFPG     LL E  K V +  DSPKPP +RITFT PV+  +  +  V  G+ K + +      +  +D LP  +   L  E+ +WF+++ A  K+
Sbjct:    4 VGVFSERASLTHQLGEFIVKKQDEALQKKSDFKVSVSGGSLIDALYESLVADESLSSRVQWSKWQIYFSDERIVPLTDADSNYGAFKRAVLDKLPSTSQPNVYPMDESLIGSDAESN-----------NKIAAEYERIVPQVLDLVLLGCGPDGHTCSLFPGETHRYLLNETTKRVAWCHDSPKPPSDRITFTLPVLKDAKALCFVAEGSSKQNIMHEIF--DLKNDQLPTALVNKLFGEKTSWFVNEEAFGKV 244          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: SOL3_YEAS7 (6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=SOL3 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.568e-28
Identity = 87/254 (34.25%), Postives = 130/254 (51.18%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSL-RKLVEPPYVDS-IEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTG-NVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPK-FDLMLLGMGPDGHIASLFPGHP---LLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMA--LAEEEFTWFLDKXATSKL 822
            V VF     L   L ++      +  ++K  F V +SGGSLID+L   LV    + S ++W+KW +++ DER+VP    DSNY       L ++P T+  NVY ++++L    A  +           N +A       P+  DL+LLG GPDGH  SLFPG     LL E  K V +  DSPKPP +RITFT PV+  +  +  V  G+ K + +      +  +D LP  +   L  E+ +WF+++ A  K+
Sbjct:    4 VGVFSERASLTHQLGEFIVKKQDEALQKKSDFKVSVSGGSLIDALYESLVADESLSSRVQWSKWQIYFSDERIVPLTDADSNYGAFKRAVLDKLPSTSQPNVYPMDESLIGSDAESN-----------NKIAAEYERIVPQVLDLVLLGCGPDGHTCSLFPGETHRYLLNETTKRVAWCHDSPKPPSDRITFTLPVLKDAKALCFVAEGSSKQNIMHEIF--DLKNDQLPTALVNKLFGEKTSWFVNEEAFGKV 244          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: SOL3_YEAS6 (6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SOL3 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.568e-28
Identity = 87/254 (34.25%), Postives = 130/254 (51.18%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSL-RKLVEPPYVDS-IEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTG-NVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPK-FDLMLLGMGPDGHIASLFPGHP---LLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMA--LAEEEFTWFLDKXATSKL 822
            V VF     L   L ++      +  ++K  F V +SGGSLID+L   LV    + S ++W+KW +++ DER+VP    DSNY       L ++P T+  NVY ++++L    A  +           N +A       P+  DL+LLG GPDGH  SLFPG     LL E  K V +  DSPKPP +RITFT PV+  +  +  V  G+ K + +      +  +D LP  +   L  E+ +WF+++ A  K+
Sbjct:    4 VGVFSERASLTHQLGEFIVKKQDEALQKKSDFKVSVSGGSLIDALYESLVADESLSSRVQWSKWQIYFSDERIVPLTDADSNYGAFKRAVLDKLPSTSQPNVYPMDESLIGSDAESN-----------NKIAAEYERIVPQVLDLVLLGCGPDGHTCSLFPGETHRYLLNETTKRVAWCHDSPKPPSDRITFTLPVLKDAKALCFVAEGSSKQNIMHEIF--DLKNDQLPTALVNKLFGEKTSWFVNEEAFGKV 244          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: SOL3_YEAS1 (6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SOL3 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.568e-28
Identity = 87/254 (34.25%), Postives = 130/254 (51.18%), Query Frame = 1
Query:   88 VQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSL-RKLVEPPYVDS-IEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTG-NVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPK-FDLMLLGMGPDGHIASLFPGHP---LLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMA--LAEEEFTWFLDKXATSKL 822
            V VF     L   L ++      +  ++K  F V +SGGSLID+L   LV    + S ++W+KW +++ DER+VP    DSNY       L ++P T+  NVY ++++L    A  +           N +A       P+  DL+LLG GPDGH  SLFPG     LL E  K V +  DSPKPP +RITFT PV+  +  +  V  G+ K + +      +  +D LP  +   L  E+ +WF+++ A  K+
Sbjct:    4 VGVFSERASLTHQLGEFIVKKQDEALQKKSDFKVSVSGGSLIDALYESLVADESLSSRVQWSKWQIYFSDERIVPLTDADSNYGAFKRAVLDKLPSTSQPNVYPMDESLIGSDAESN-----------NKIAAEYERIVPQVLDLVLLGCGPDGHTCSLFPGETHRYLLNETTKRVAWCHDSPKPPSDRITFTLPVLKDAKALCFVAEGSSKQNIMHEIF--DLKNDQLPTALVNKLFGEKTSWFVNEEAFGKV 244          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_DROME (Probable 6-phosphogluconolactonase OS=Drosophila melanogaster GN=CG17333 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 5.957e-28
Identity = 81/208 (38.94%), Postives = 113/208 (54.33%), Query Frame = 1
Query:  103 SEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSA-EGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPL-LKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQT 720
            SEE L  +L       S +   +   F+V LSGGSL+  L K ++     +++ AKW  F+ DER V  D  DS Y      +L+Q+P    + +   D     +  A DYE  +K             +   +FDL+LLGMGPDGH  SLFP  P  L+E ++ V  I++SPKPPPERITFT P+IN +  +A VV GA K+S V++
Sbjct:   15 SEEQLVQALGDLLQRCSQEALAKHDKFSVGLSGGSLVQLLTKALKSC---NLKTAKWVFFFCDERYVRLDDSDSTYGAYRAEWLTQLPCIQESQFVRADTSQPLDACAADYEAKVK-------------SQVDRFDLLLLGMGPDGHTCSLFPEQPATLQETKRLVIPIRNSPKPPPERITFTLPLINKARNVAFVVTGAAKASVVKS 206          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_SYNY3 (6-phosphogluconolactonase OS=Synechocystis sp. (strain PCC 6803) GN=pgl PE=1 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 8.602e-27
Identity = 80/222 (36.04%), Postives = 110/222 (49.55%), Query Frame = 1
Query:  169 EKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAI-NDALSAEGAAEDYETCLKHLTKSNILAT---SAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATSKL 822
            E+G  T+ LSGG+   + + L E     ++ W K HVFW DER V  DH DSN ++A   +L QV I   N++ +   A   E  A+ YE         N LAT     A  FP FDL+LLG+G DGH ASLFP  P L   ++ +T      +P   R+TFT P+IN +  +  +V GA K  A+        +    P +    + E  W LD+ A   L
Sbjct:   32 ERGQGTIALSGGN---TPKPLYEALARQALPWEKIHVFWGDERYVSVDHPDSNQRMARLAWLDQVDIPEANIHPMPTAAADPEQDAQTYE---------NELATFFQVEAGHFPAFDLILLGLGDDGHTASLFPHTPALTVGDRLITVGNKDGQP---RLTFTIPLINRARSVVFLVAGASKQHALGEIFAPEADPQQYPARFIQPQGELIWLLDQQAGENL 238          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_STRCO (6-phosphogluconolactonase OS=Streptomyces coelicolor GN=pgl PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 8.602e-27
Identity = 77/223 (34.53%), Postives = 116/223 (52.02%), Query Frame = 1
Query:  172 KGSFTVVLSGGSLIDSL-RKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDA-----LSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATSKL 822
            +GS +VVL+GG   + L   L   P  D+I+W++  ++W DER +P+   + N   A    L  VP+    V+A+  +        E AA  Y    + L  +++    AA   P FD++LLG+GPD H+ASLFP HP ++E E+ V  +  SPKPPP RI+ T P I ++  + ++  G  K++AV  AL +       P   A       W LD  A S+L
Sbjct:   35 RGSASVVLTGGRNGNGLLAALAGSPARDAIDWSRLDLWWGDERFLPEGDPERNVTQAQQALLDSVPLDPKRVHAMAASDGPYGSDVEAAAAAYA---QELATASVPENHAAV--PSFDVLLLGVGPDTHVASLFPEHPGVRETERTVIGVHGSPKPPPIRISLTLPAIRAAREVWLLAAGEDKANAVAMAL-SGAGEIQAPAAGARGRARTLWLLDSAAASQL 251          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: 6PGL_ANASP (6-phosphogluconolactonase OS=Anabaena sp. (strain PCC 7120) GN=pgl PE=2 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 8.602e-27
Identity = 78/224 (34.82%), Postives = 111/224 (49.55%), Query Frame = 1
Query:  166 KEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAI-----NDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXATSKL 822
            K++G FT+ LSGGS   + + L E      + W K HVFW DER V  DH DSN  +A   +L +V I   N++A+     N A+SA    +  +T             SA   FP  D++LLGMG D H ASLFP    L+  ++ +T       P   RITFT+P IN+++ +  VV GA K  A+      + +    P +    + E  W LD  A ++L
Sbjct:   31 KQQGRFTIALSGGS---TPKPLYEAIAAQKLPWDKIHVFWGDERYVSPDHPDSNELMARTAWLDRVDIPAENIHAVPTLDNNPAVSAAKYEQHLQT----------FFNSAPGEFPALDVVLLGMGDDAHTASLFPHTEALQVRDRLITVGNKDGNP---RITFTYPFINAASSVIFVVAGANKRPALAQVFAPSADDLAYPSRFIQPQGELLWLLDAAAGAEL 238          
BLAST of DC900291 vs. ExPASy Swiss-Prot
Match: SOL1_YEAST (6-phosphogluconolactonase-like protein 1 OS=Saccharomyces cerevisiae GN=SOL1 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.119e-25
Identity = 85/263 (32.32%), Postives = 128/263 (48.67%), Query Frame = 1
Query:   43 ASSSMAAENKNKNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGS-FTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPIT---TGNVYAINDAL--SAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPG-HPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKXA 810
            + +S+      ++K ++  +S    A S        + K  KEK   F + LSGGSLI  L + +     D ++W KW +++ DER+VP    +SNY LA       +      T  +Y I+++L    +  A++YE   K L K    A   +   P FDL LLG  PDGHIASLFP     L+EN  WV  ++++P  P  RI+ T PVI  S  +  VV GA K+  ++T +   +      +    A    +WF+D  A
Sbjct:   45 SGTSLNGNGNTESKTMERVNSVRSNASSRGGSEDGATKKLKKEKERRFKIALSGGSLIQVLHEGLLKR--DDVQWGKWDIYFADERLVPFSSSESNYGLAKRKIFDLIDTEKYGTPKIYHIDESLINDPQECADNYE---KILIKG--FAGRDSVKLPMFDLFLLGCAPDGHIASLFPNFQENLRENLAWVIPVENAPSGPSNRISLTIPVICHSHRVTFVVEGATKAPVIKTIMERPEKGLPSSIVNEGAAGRVSWFVDDDA 300          
The following BLAST results are available for this feature:
BLAST of DC900291 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
6PGL_MYCLE2.188e-3034.546-phosphogluconolactonase OS=Mycobacterium leprae ... [more]
SOL3_YEAST1.568e-2834.256-phosphogluconolactonase 3 OS=Saccharomyces cerev... [more]
SOL3_YEAS71.568e-2834.256-phosphogluconolactonase 3 OS=Saccharomyces cerev... [more]
SOL3_YEAS61.568e-2834.256-phosphogluconolactonase 3 OS=Saccharomyces cerev... [more]
SOL3_YEAS11.568e-2834.256-phosphogluconolactonase 3 OS=Saccharomyces cerev... [more]
6PGL_DROME5.957e-2838.94Probable 6-phosphogluconolactonase OS=Drosophila m... [more]
6PGL_SYNY38.602e-2736.046-phosphogluconolactonase OS=Synechocystis sp. (st... [more]
6PGL_STRCO8.602e-2734.536-phosphogluconolactonase OS=Streptomyces coelicol... [more]
6PGL_ANASP8.602e-2734.826-phosphogluconolactonase OS=Anabaena sp. (strain ... [more]
SOL1_YEAST2.119e-2532.326-phosphogluconolactonase-like protein 1 OS=Saccha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900291 VSS Citrus sinensis cDNA clone VS28637 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900291 ID=DC900291|Name=DC900291|organism=Citrus sinensis|type=EST|length=991bp
GAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGACAAGGCATCATC
ATCAATGGCTGCCGAGAATAAGAACAAGAACAAGAACGTACAAGTTTTTG
ACTCAGAGGAAGATCTGGCTGTGTCTTTGGCCAAATACACCGCCGATCTA
TCTGCCAAGTTCGGTAAAGAGAAGGGCTCCTTCACTGTCGTCTTATCCGG
TGGTTCTCTCATCGACTCCCTCAGGAAATTAGTGGAACCCCCGTATGTAG
ATTCAATTGAATGGGCGAAATGGCATGTGTTTTGGGTTGATGAAAGAGTT
GTTCCCAAGGATCATGATGATAGCAATTATAAGCTTGCTTATGATGGTTT
CCTTTCTCAGGTACCAATTACCACTGGCAATGTCTATGCCATCAATGATG
CATTATCTGCTGAAGGTGCAGCTGAAGATTACGAGACTTGTCTCAAGCAT
TTGACAAAGAGCAATATATTAGCTACATCTGCTGCTACTGGTTTTCCAAA
GTTTGATCTCATGCTTCTGGGTATGGGTCCAGATGGACATATAGCTTCTC
TGTTTCCAGGGCATCCTCTTCTCAAGGAGAATGAGAAATGGGTTACTTTC
ATTAAAGACTCGCCAAAGCCACCTCCAGAGAGAATCACTTTCACCTTCCC
TGTAATCAACTCATCTGCATATATTGCAATGGTGGTGTGTGGTGCTGGAA
AATCAAGTGCAGTTCAAACTGCATTGGGTAATAATCAAAACTCTGATTTG
CTGCCAGTTCAAATGGCATTGGCTGAAGAAGAATTCACTTGGTTTCTTGA
CAAANACGCGACTTCAAAGCTGTAAGAGTCAGAACAATTTGCTGTATGCA
TGAATCCCTGTTATCTGCTATGATAATTGGTTTGATCTGTGTGGTTTGAC
TACTAGTACTGCTGGATTTTGTTAGTAATGAGAACAGAGTGAACTTGTTA
ATGCAAGTGAAAAAGATTTGAATAAATATAGTTTGATATTT
back to top