DC900286

Overview
NameDC900286
Unique NameDC900286
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1248
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP4_HUMAN (Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.815e-27
Identity = 71/144 (49.31%), Postives = 95/144 (65.97%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVI-------PSGY--PSL--------YYTTPPGIVSQVPPRP 383
            N+Y+KN+DD + DE+L+  FS  G+ITSAKVM ++ G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+R+AHL  QY Q +AG+    AN I         GY  P++        YYT  P  ++Q+ P P
Sbjct:  295 NLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLED-GRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYT--PNQLAQMRPNP 435          

HSP 2 Score: 85.1149 bits (209), Expect = 9.341e-16
Identity = 43/91 (47.25%), Postives = 59/91 (64.84%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  ++V DE LK  FSQ G   S KVMRD  G +KGFGFV +   E+A+KAV   +G  +  K ++V  AQ+K +RQA L+ ++ Q
Sbjct:  192 NVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQ 282          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP3_ARATH (Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 3.095e-27
Identity = 70/157 (44.59%), Postives = 100/157 (63.69%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ-----HMAGIEGSSANVIPSGYPSLYYTTPPGIVSQVPPRP-GLMYQPL---GLRTGWRANGFVPP 446
            N+Y+KN+DD V DE+LK  FS+ G +TS+KVM + +G+++GFGFV +S+PEEA +A++  +G M+ RKPLY+A+AQRKEDR+AHLQ  ++Q      M+G        +P G P   Y    G  S VP +P G  +QP    G+R G     F+ P
Sbjct:  333 NLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMSRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIALAQRKEDRRAHLQALFSQIRAPGPMSGFHHPPGGPMP-GPPQHMYVGQNG-ASMVPSQPIGYGFQPQFMPGMRPGSGPGNFIVP 487          

HSP 2 Score: 74.7146 bits (182), Expect = 1.262e-12
Identity = 38/91 (41.76%), Postives = 57/91 (62.64%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVYVKN+  ++ ++EL+  F + G I+SA VMRD+ G ++ FGFV F   E A+ AV   +G  L    LYV  AQ+K +R+  L+ ++ Q
Sbjct:  230 NVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGNSRCFGFVNFECTEAAASAVEKMNGISLGDDVLYVGRAQKKSEREEELRRKFEQ 320          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_KLULA (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis GN=PAB1 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 4.469e-26
Identity = 79/185 (42.70%), Postives = 108/185 (58.38%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDR--------QAHLQLQYAQHMAGIEGSSANVIPSGY-PSLYY--TTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTR--------PAFQVSPLPVN--PKH 494
            N+++KN+DD + DE+LK  F+  GTITSA+VMRD++G +KGFGFVCFSSPEEA+KA+   +  ++  KPLYVAIAQRK+ R        QA  Q+++ Q       ++A  +P  Y P ++Y    P G      P PG M  P+G   G   NG VPP +        P +Q  P P N  P+H
Sbjct:  335 NLFIKNLDDSIDDEKLKEEFAPYGTITSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQIRFQQQQQQQAAAAAAGMPGQYMPQMFYGVMAPRGFPG---PNPG-MNGPMG--AGIPKNGMVPPPQQFAGRPNGPMYQGMP-PQNQFPRH 512          

HSP 2 Score: 80.1073 bits (196), Expect = 3.005e-14
Identity = 43/92 (46.74%), Postives = 56/92 (60.87%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQH 278
            N+YVKNID + TDEE +  FSQ G I SA + +D +G  KGFGFV F     A+KAV   +G     + LYV  AQ+K +R   L+ QY Q+
Sbjct:  232 NIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQKKYERAEELKKQYEQY 323          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_CRYNE (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans GN=PAB1 PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 7.624e-26
Identity = 63/134 (47.01%), Postives = 86/134 (64.18%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYA-------QHMAGIEGSSANVIPSGYPSLYYTTPPGIVSQVPPRP 383
            N+YVKN+DD+  D+ L+A F   GTITS+KVMRD+ G+++GFGFVC+SSP+EA+KAV+  +G M+  KPLYVA+AQRK+ R+  L+ Q A       Q+ AG  G    +   G P   Y   PG    +P  P
Sbjct:  331 NLYVKNLDDEWDDDRLRAEFEAFGTITSSKVMRDDSGVSRGFGFVCYSSPDEATKAVSEMNGKMIGTKPLYVALAQRKDVRRQALESQIAQRAQQRMQYGAGFPGMQGYM---GQPMYGYPPMPGYGQPMPGMP 461          

HSP 2 Score: 76.6406 bits (187), Expect = 3.322e-13
Identity = 41/103 (39.81%), Postives = 59/103 (57.28%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANV 311
            NVY+KN+D +VTD E +      G   S  + RDEKG++KGFGFV + + E A KAV+  +   ++ K LY   AQ K +R+A L+  + +     E  SA V
Sbjct:  228 NVYIKNVDLEVTDAEFEDLVKPFGPTISVALSRDEKGVSKGFGFVNYENHESARKAVDELNEKEVNGKKLYAGRAQTKSEREAELKKSHEEKRLENEAKSAGV 330          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_YEAST (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae GN=PAB1 PE=1 SV=4)

HSP 1 Score: 118.242 bits (295), Expect = 9.957e-26
Identity = 75/168 (44.64%), Postives = 98/168 (58.33%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDR--------QAHLQLQYAQHMAGIEGSSANVIPSGYPSLYY-TTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTR--PAFQVSP 473
            N++VKN+DD V DE+L+  F+  GTITSAKVMR E G +KGFGFVCFS+PEEA+KA+   +  ++  KPLYVAIAQRK+ R        QA  Q++Y Q  A    ++A +     P ++Y   PP  V    P P  M  P+G   G   NG  P  R  P + V P
Sbjct:  323 NLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQQATAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQM-NPMG---GMPKNGMPPQFRNGPVYGVPP 486          

HSP 2 Score: 72.4034 bits (176), Expect = 6.266e-12
Identity = 38/89 (42.70%), Postives = 55/89 (61.80%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            N+YVKNI+ + TDE+ +  F++ G I SA + +D  G  KGFGFV +   E+A KAV   +   L+ + LYV  AQ+K +R   L+ QY
Sbjct:  220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQY 308          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_DROME (Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3)

HSP 1 Score: 116.701 bits (291), Expect = 2.897e-25
Identity = 55/96 (57.29%), Postives = 73/96 (76.04%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGI 290
            N+YVKN+DD + D+ L+  FS  G ITSAKVM DE+G +KGFGFVCF++  EA+ AV   +G ++  KPLYVA+AQRKE+R+AHL  QY +HM G+
Sbjct:  288 NLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGRSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEERKAHLASQYMRHMTGM 383          

HSP 2 Score: 79.7221 bits (195), Expect = 3.925e-14
Identity = 45/92 (48.91%), Postives = 56/92 (60.87%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGY-MLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVYVKN  +D  DE+LK  F   G ITS KVM  E G +KGFGFV F + E A  AV   +G  M   K LYVA AQ+K +RQ  L+ ++ +
Sbjct:  184 NVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEE 275          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_YARLI (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica GN=PAB1 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 4.942e-25
Identity = 70/162 (43.21%), Postives = 96/162 (59.26%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHL--QLQYAQHMAGIEGSSANVIPSGY---PSLYYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTRPAFQVSP 473
            N+Y+KN+DD + D++L+A F+  GTITSAKVM DE G +KGFGFVC+SSPEEA+KAV   +  ++  KPLYV +AQRK+ R++ L  Q+Q    M   + ++A  +P  Y   P ++Y   PG    +PP  G M  P G           PP  P  Q  P
Sbjct:  331 NLYIKNLDDTIDDDKLRAEFAPHGTITSAKVMVDEAGKSKGFGFVCYSSPEEATKAVTEMNHRLVAGKPLYVVLAQRKDVRRSQLQQQIQAKNQMRLQQQAAAGGLPGQYMGNPGVFYPGQPGF---MPPGRGGM--PFGANPQMMMR---PPMPPQNQFPP 484          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP5_ARATH (Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 4.942e-25
Identity = 68/161 (42.24%), Postives = 96/161 (59.63%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIPSGYPSLYYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVP--PTRPAFQVSPLP 479
            N+Y+KN+DD V DE+LK  FS+ G +TS KVM + +G+++GFGFV +S+PEEA  A+   +G M+ RKPLYVA+AQRKE+RQAHLQ  + Q  +     + + +PS   S ++  PPG     P  P        +  G    G VP  P    +QV  +P
Sbjct:  329 NLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALAQRKEERQAHLQSLFTQIRS---PGTMSPVPSPM-SGFHHHPPGGPMSGPHHP--------MFIGHNGQGLVPSQPMGYGYQVQFMP 477          

HSP 2 Score: 85.5001 bits (210), Expect = 7.152e-16
Identity = 43/91 (47.25%), Postives = 60/91 (65.93%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVYVKN+  ++TD+ELK  F + G I+SA VM+D+ G ++ FGFV F SPE A+ AV   +G  L    LYV  AQ+K DR+  L+ ++ Q
Sbjct:  226 NVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRAQKKSDREEELRRKFEQ 316          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_ASHGO (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii GN=PAB1 PE=3 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 6.454e-25
Identity = 69/151 (45.70%), Postives = 91/151 (60.26%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHL--QLQYAQHMAGIEGSSANVIP-SGYPSLYYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPP 446
            N++VKN+DD + DE+LK  F+  GTITSAKVMRDE G ++GFGFVCFS+PEEA+KA+   +  ++  KPLYVAIAQRKE R+  L  Q+Q    M     ++A     +G P   +  PP     +PPR      P     G   NG +PP
Sbjct:  323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMRFQHANAAAAAAVAGLPG-QFMPPPMYYGGIPPRVPFQ-GPNPQMAGMPKNGAMPP 471          

HSP 2 Score: 70.4774 bits (171), Expect = 2.381e-11
Identity = 32/86 (37.21%), Postives = 53/86 (61.63%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQ 260
            N+Y+KN+   + ++ L   FS  G I S KV  DE G+++GFGFV F +  +A  A+    G +++ + +YVA+   K+DRQ+ L+
Sbjct:  127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLE 212          

HSP 3 Score: 70.0922 bits (170), Expect = 3.110e-11
Identity = 38/89 (42.70%), Postives = 53/89 (59.55%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVYVKNID + + EE +  F + G ITSA + +D +G  +GFGFV F     A+KAV+  +      + LYV  AQ+K +R   L+ QY
Sbjct:  220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQY 308          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PAP1L_HUMAN (Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.101e-24
Identity = 74/169 (43.79%), Postives = 96/169 (56.80%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIPS-GYPSLYY----TTPP--------GIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTRPAFQVS 470
            N+YVKN+DD + D++L+  FS  G ITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+R+A L  QY Q ++ +   S  ++ S   PS Y+      PP        G V+   P P    QP            V P RP   +S
Sbjct:  295 NLYVKNLDDSIDDDKLRKEFSPYGVITSAKVMT-EGGHSKGFGFVCFSSPEEATKAVTEMNGRIVGTKPLYVALAQRKEERKAILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQPAPRWTSQPPRPSCASMVRPPVVPRRPPAHIS 462          

HSP 2 Score: 72.0182 bits (175), Expect = 8.183e-12
Identity = 39/91 (42.86%), Postives = 56/91 (61.54%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            N+YVKN+  DV ++ L+  FSQ G + S KVMRD  G ++ FGFV F   EEA KAV   +G  +  + LY   AQ++ +RQ  L+ ++ Q
Sbjct:  192 NIYVKNLPVDVDEQGLQDLFSQFGKMLSVKVMRDNSGHSRCFGFVNFEKHEEAQKAVVHMNGKEVSGRLLYAGRAQKRVERQNELKRRFEQ 282          
The following BLAST results are available for this feature:
BLAST of DC900286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
PABP4_HUMAN1.815e-2749.31Polyadenylate-binding protein 4 OS=Homo sapiens GN... [more]
PABP3_ARATH3.095e-2744.59Polyadenylate-binding protein 3 OS=Arabidopsis tha... [more]
PABP_KLULA4.469e-2642.70Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_CRYNE7.624e-2647.01Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_YEAST9.957e-2644.64Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_DROME2.897e-2557.29Polyadenylate-binding protein OS=Drosophila melano... [more]
PABP_YARLI4.942e-2543.21Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP5_ARATH4.942e-2542.24Polyadenylate-binding protein 5 OS=Arabidopsis tha... [more]
PABP_ASHGO6.454e-2545.70Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PAP1L_HUMAN1.101e-2443.79Polyadenylate-binding protein 1-like OS=Homo sapie... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900286 VSS Citrus sinensis cDNA clone VS28632 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900286 ID=DC900286|Name=DC900286|organism=Citrus sinensis|type=EST|length=1248bp
CAAATGTTTATGTGAAGAACATTGATGATGATGTTACCGATGAAGAGCTA
AAAGCGCACTTCAGTCAGTGTGGCACAATTACTTCAGCAAAAGTGATGCG
AGATGAGAAAGGAATAAATAAGGGCTTTGGATTTGTGTGCTTCTCAAGCC
CAGAGGAGGCCAGTAAAGCTGTGAACACTTTCCATGGTTACATGTTACAC
CGCAAGCCATTGTACGTGGCTATTGCTCAAAGGAAGGAGGACAGACAAGC
ACATCTGCAACTTCAGTATGCACAGCATATGGCTGGAATAGAAGGAAGTT
CAGCTAATGTTATTCCCAGTGGATATCCTTCTCTTTACTACACAACTCCT
CCAGGTATTGTTTCACAAGTACCACCACGTCCTGGGCTGATGTACCAACC
TTTGGGTTTGAGGACGGGTTGGAGGGCCAATGGCTTTGTGCCACCAACCA
GACCAGCATTTCAAGTATCACCACTGCCAGTTAACCCAAAACACAATAGG
CAAAACAGAGGTAGGATGAATGGGAATATGCTTCCACAAGTAGGTGCTCA
CTATATGCAACAGTCCTCTCAATCTGCAGCTTCTTCAAAAGATTCAAGCA
ATCAACAGAAGGGTGGGCAAAGCAAGTATGTACCAAATGGTCGTACACGT
GAGTTAAACAAAGGATCTGGAGTCTCATTAGGTACTTTTAAATTCTGGTG
GAGTAATGGCGCGGAAACCAGATATGCTCAATGGTATGCTTGCCGCAGCT
TCCCCTGAGCAACAAAAACAGATACTTGGAGAGCGTCTGTACCCTCTTGT
CGAGAAACACAAGCCTGATCTTGTTGCCAAAATTACGGGAATGCTACTAC
AGATGGACAACTCGGAACTGCTGCTGTTATTGGAATCACCAGAGTCATTG
GCTGTAAAAGTGGAGGAAGCTGTGCAAGTGCTAAAGCTCTCAGAAGCCAA
AGTTTCAACTCAGGAAGCCATTCATCCCAATTACCTATCTGCTGAGGTTG
CAGTCAATTGAGAAGGCAAGCCCAAATTGTGCTGAAAAATATAGAGGTGC
TCACCAAATCGAAGAGGCCAAACTTGTTTTTGATACCATTAGCGAACATT
CATTTAGTTCATTTGTTTCTTTTTTTTTGTTTTTTTTTAACTGTTATTAG
AATCATTTTCTTTTTGGGTATAGGACATTGTTTCGTGTCTTTATTGAAGA
AGAAAGATTGATACTGTTGATCCTATGTTTATTTAACTGACAACTATT
back to top