DC900286

Overview
NameDC900286
Unique NameDC900286
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1248
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_CANGA (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata GN=PAB1 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 2.295e-22
Identity = 60/137 (43.80%), Postives = 84/137 (61.31%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDR--------QAHLQLQYAQHMAGIEGSSANVIPSGY--PSLYYTTPPGIVSQVPPRP 383
            N+++KN+DD + D++L+  F+  GTITSAKVM  E G +KGFGFVCFS+PEEA+KA+   +  ++  KPLYVAIAQRK+ R        QA  Q+++ Q  A    ++A  +P  +  P  Y   PP  V    P P
Sbjct:  320 NLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQQASAAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNP 456          

HSP 2 Score: 69.707 bits (169), Expect = 4.061e-11
Identity = 37/89 (41.57%), Postives = 53/89 (59.55%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVY+KNI+ + TD+E +   ++ G   S  + R  +G NKGFGFV F + E+A K V   +      +PLYV  AQ+K +RQ  L+ QY
Sbjct:  217 NVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQY 305          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_LODEL (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus GN=PAB1 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.114e-22
Identity = 60/145 (41.38%), Postives = 89/145 (61.38%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHL--QLQYAQHMAGIEGSSANVIPSGY-PSLYYTT----PPGIVSQVP---PRPGLMYQPLG 407
            N++VKN+D+ +  E+L+  F   GTITS+KVM D+ G +KGFGFVCFS+PEEA+KA+   +  M++ KPLYVA+AQRK+ R++ L  Q+Q    M     ++A  +P  + P ++Y      PP      P   P P +M +  G
Sbjct:  352 NLFVKNLDEQIDSEKLEEEFKPFGTITSSKVMVDDAGKSKGFGFVCFSTPEEATKAITEMNQRMVNGKPLYVALAQRKDVRRSQLEQQIQARNQMRMQNAAAAGGLPGQFMPPMFYGQQGFFPPNGRGNAPFPGPNPQMMMRGRG 496          

HSP 2 Score: 70.8626 bits (172), Expect = 1.823e-11
Identity = 37/89 (41.57%), Postives = 55/89 (61.80%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            N+YVKNID   T++E +  F+  G ITS  + +D +G +KGFGFV F   E A+KAV   +   ++ + +YV  AQ+K +R   L+ QY
Sbjct:  249 NIYVKNIDLAYTEKEFEELFAPFGKITSIYLEKDAEGKSKGFGFVNFEEHEAAAKAVEELNDKEINGQKIYVGRAQKKRERTEELKKQY 337          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_NEOFI (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.375e-19
Identity = 78/226 (34.51%), Postives = 105/226 (46.46%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRD------------------------------------------EK---GINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQ--LQYAQHMAGIEGSSANVIPSGY--PSLYY------------------TTPPGIVSQVP-PRPGLMYQPLGLRTGWRANGFVPPTRPAFQVSPL 476
            N+YVKN+ DDV DE+L+  FS  GTITSAKVMRD                                          EK   G +KGFGFVCFSSP+EASKAV   +  M++ KPLYVA+AQRK+ R++ L+  +Q    +   + ++A  +P  Y  P+++Y                     PG+V  +P  RPG    P   + G R  G      P FQ  P+
Sbjct:  337 NLYVKNLTDDVDDEKLRELFSPFGTITSAKVMRDTVTAGETSESEKEKESNKENEKEGEEKTEEKPKESEEEAKKTEKKILGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFYGPGQQGFIPAGQRGGMPFAPQPGMVMGIPGGRPGQYPGPFPGQQGGRGMGPNQQIPPNFQGIPM 562          

HSP 2 Score: 83.9593 bits (206), Expect = 2.081e-15
Identity = 41/89 (46.07%), Postives = 60/89 (67.42%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVY+KNID +VTDEE +  F + G ITSA + RD++G ++GFGFV FS+ + A  AV+  +   +  + LYV  AQ+K +R+  L+ QY
Sbjct:  234 NVYIKNIDQEVTDEEFRKMFEKFGEITSATLSRDQEGKSRGFGFVNFSTHDSAQAAVDEMNDKEIKGQKLYVGRAQKKHEREEELRKQY 322          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_ASPFU (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus fumigatus GN=pab1 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 4.052e-19
Identity = 78/228 (34.21%), Postives = 105/228 (46.05%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRD--------------------------------------------EK---GINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQ--LQYAQHMAGIEGSSANVIPSGY--PSLYY------------------TTPPGIVSQVP-PRPGLMYQPLGLRTGWRANGFVPPTRPAFQVSPL 476
            N+YVKN+ DDV DE+L+  FS  GTITSAKVMRD                                            EK   G +KGFGFVCFSSP+EASKAV   +  M++ KPLYVA+AQRK+ R++ L+  +Q    +   + ++A  +P  Y  P+++Y                     PG+V  +P  RPG    P   + G R  G      P FQ  P+
Sbjct:  337 NLYVKNLTDDVDDEKLRELFSPFGTITSAKVMRDTVTTGETSESEKEKEKESNKENEKEGEEKTEEKPKESEEEPKKTEKKILGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFYGPGQQGFIPAGQRGGMPFAPQPGMVMGIPGGRPGQYPGPFPGQQGGRGMGPNQQIPPNFQGIPM 564          

HSP 2 Score: 83.9593 bits (206), Expect = 2.081e-15
Identity = 41/89 (46.07%), Postives = 60/89 (67.42%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVY+KNID +VTDEE +  F + G ITSA + RD++G ++GFGFV FS+ + A  AV+  +   +  + LYV  AQ+K +R+  L+ QY
Sbjct:  234 NVYIKNIDQEVTDEEFRKMFEKFGEITSATLSRDQEGKSRGFGFVNFSTHDSAQAAVDEMNDKEIKGQKLYVGRAQKKHEREEELRKQY 322          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_NEUCR (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa GN=pab-1 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 5.292e-19
Identity = 65/189 (34.39%), Postives = 94/189 (49.74%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRD-----------------------------------------EKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQ-YAQHMAGIEGSSANVIPSGYPSLYYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVP 443
            N+Y+KN+ DDV D++L+A FS+ G ITSAKVMRD                                         + G +KGFGFVCFS+P++A+KAV   +  M+  KPLYVA+AQRK+ R++ L+    A++   ++ ++A    +G P  Y   P     Q   +PG M  P G    +   G VP
Sbjct:  345 NLYIKNLGDDVDDDKLRAMFSEYGPITSAKVMRDSLIEGSEEKDEKDKENKKEGETKEEEQNEGSEKKTEKKGDRKLGKSKGFGFVCFSNPDDATKAVTEMNQRMVDGKPLYVALAQRKDVRKSQLEASIQARNQLRMQQAAAQ---AGMPQQYMQAPVYYAGQ---QPGFMPAPGGRGVPFPQGGIVP 527          

HSP 2 Score: 82.4185 bits (202), Expect = 6.055e-15
Identity = 39/89 (43.82%), Postives = 63/89 (70.79%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVYVKNI+++VTDEE +  F++ G +TS+ + RD++G ++GFGFV F++ E A++AV+  +G     + LYV  AQ+K +R+  L+  Y
Sbjct:  242 NVYVKNINNEVTDEEFRELFAKFGEVTSSSLARDQEGKSRGFGFVNFTTHEAAAQAVDELNGKDFRGQDLYVGRAQKKHEREEELRKSY 330          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_ASPTN (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.179e-18
Identity = 74/217 (34.10%), Postives = 102/217 (47.00%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEK---------------------------------------------------GINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQ--LQYAQHMAGIEGSSANVIPSGY--PSLYYTTPPGIVSQVP--PRPGLMYQPL-GLRTGWRANGFVPPTRPAFQVSPLP 479
            N+YVKN+ DD+ DE+L+  F+  GTITSAKVMRD                                                     G +KGFGFVCFSSP+EASKAV   +  M++ KPLYVA+AQRK+ R++ L+  +Q    +   + ++A  +P  Y  P+++Y   PG    +P   R GL + P  G+  G      VP  RP     P P
Sbjct:  333 NLYVKNLTDDIDDEKLREMFAPYGTITSAKVMRDTNIERTQTPDSDKEKKEESKEEKPEAAEKTEEAAKESGDDQDKENKKSDKKVLGKSKGFGFVCFSSPDEASKAVTEMNQRMINGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFY--GPGQQGFIPGGQRGGLPFAPQPGMMMG------VPGGRPGQYPGPFP 541          

HSP 2 Score: 78.1814 bits (191), Expect = 1.142e-13
Identity = 36/89 (40.45%), Postives = 60/89 (67.42%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVY+KN+D ++++EE +  F + G ITSA + RD++G ++GFGFV +S+ + A  AV+  +   +  + LYV  AQ+K +R+  L+ QY
Sbjct:  230 NVYIKNLDQEISEEEFRQMFEKFGEITSATLSRDQEGKSRGFGFVNYSTHDSAQAAVDEMNDKEVKGQKLYVGRAQKKHEREEELRKQY 318          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_COCIM (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis GN=PAB1 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.626e-18
Identity = 68/194 (35.05%), Postives = 97/194 (50.00%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMR-----------------------------DEKGIN------------------------KGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQ--LQYAQHMAGIEGSSANVIPSGY--PSLYYTTPPGIVSQVP-PRPGLMYQPLGL 410
            N+Y+KN+ DD+ DE+L+  FS  GTITSAKVMR                             DE G N                        KGFGFVCFSSP+EASKAV   +  M+H KPLYVA+AQRK+ R++ L+  +Q    +   + ++A  +P  +  P+++Y   PG  + +P  R G+ +Q  G+
Sbjct:  341 NLYIKNLSDDIDDEKLRELFSSYGTITSAKVMRDFAPESTSDSEKEAKKDSKEPETKEEEPKDEAGDNAENKDNKENKAESKKSEKKPLGKSKGFGFVCFSSPDEASKAVTEMNQRMVHGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPFMQPAVFY--GPGQQNFIPNQRGGMPFQQPGM 532          

HSP 2 Score: 77.411 bits (189), Expect = 1.948e-13
Identity = 42/90 (46.67%), Postives = 57/90 (63.33%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRD-EKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            NVYVKNID D T+EE +  F + G ITSA + RD E G ++GFGFV F+S + A+ AV   +      + LYV  AQ+K +R+  L+ QY
Sbjct:  237 NVYVKNIDQDTTEEEFRDLFEKFGEITSATLARDAESGKSRGFGFVNFTSHDNAAAAVEALNDKDFKGQKLYVGRAQKKHEREEELRKQY 326          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_ASPCL (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus GN=pab1 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.626e-18
Identity = 77/234 (32.91%), Postives = 104/234 (44.44%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRD--------------EKGINK---------------------------------------GFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQ--LQYAQHMAGIEGSSANVIPSGY--PSLYY------------------TTPPGIVSQVP-PRPGLMYQPLGLRTGWRANGFVPPTRPAFQVSPL 476
            N+YVKN+ DDV DE+L+  F   GTITSAKVMRD              EK +NK                                       GFGFVCFSSP+EASKAV   +  M++ KPLYVA+AQRK+ R++ L+  +Q    +   + ++A  +P  Y  P+++Y                     PG+V  +P  RPG    P   + G R  G      P FQ  P+
Sbjct:  336 NLYVKNLTDDVDDEKLRELFGPYGTITSAKVMRDSTPAERTETPDSEKEKEVNKENEKKEDEEKAAEEKPKESDEEKKDETKKSDKKLLGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFYGPGQQGFIPAGQRGGMPFAPQPGMVMGIPGGRPGQYPGPFPGQQGGRGMGPNQQMPPNFQGIPM 569          

HSP 2 Score: 85.8853 bits (211), Expect = 5.476e-16
Identity = 42/89 (47.19%), Postives = 59/89 (66.29%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            N+Y+KNID DVT+EE +  F Q G ITSA + RD +G ++GFGFV +S+ E A  AV+  H   +  + LYV  AQ+K +R+  L+ QY
Sbjct:  233 NIYIKNIDPDVTEEEFRKIFEQFGEITSATLSRDPEGKSRGFGFVNYSTHESAQAAVDEMHDKEVKTQKLYVGRAQKKHEREEELRKQY 321          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_EMENI (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans GN=pab1 PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 4.480e-18
Identity = 74/230 (32.17%), Postives = 104/230 (45.22%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRD------------------------------------------------EK---GINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQ--LQYAQHMAGIEGSSANVIPSGY--PSLYY-----------------TTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTRPAFQVSPL 476
            N+YVKN+ DDV D++L+  F   GTITSAKVMRD                                                EK   G +KGFGFVCFSSP+EASKAV   +  M++ KPLYVA+AQRK+ R++ L+  +Q   ++   + ++A  +   Y  P+++Y                    PG++  +P RPG    P   + G R  G      P FQ  P+
Sbjct:  327 NLYVKNLTDDVDDDKLRELFGPYGTITSAKVMRDTAPVETATPESETKESANKENEKAAEGEKEPAAEEKEKEEKKEAEQKPEKKPLGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVALAQRKDVRRSQLEASIQARNNIRQQQAAAAAGMGQAYMAPAVFYGPGQQGFIPGAQRGGMFPPQPGMMMGMPGRPGQYPGPFPGQQGGRGVGPNQQIPPNFQGLPM 556          

HSP 2 Score: 80.8777 bits (198), Expect = 1.762e-14
Identity = 40/89 (44.94%), Postives = 57/89 (64.04%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            N+Y+KNID +V DEE +  F + G ITSA + RD +G ++GFGFV FS+ E A  AV   +   +  + LYV  AQ+K +R+  L+ QY
Sbjct:  224 NIYIKNIDPEVEDEEFRKLFEKFGEITSATLSRDSEGKSRGFGFVNFSTHESAQAAVEEMNDKEVRSQKLYVGRAQKKHEREEELRKQY 312          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP_PHANO (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum GN=PAB1 PE=3 SV=3)

HSP 1 Score: 87.0409 bits (214), Expect = 2.458e-16
Identity = 65/194 (33.51%), Postives = 87/194 (44.85%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKV-MRDEK----------------------------------------------------GINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDR------------QAHLQLQYAQHMAGIEGSSANVIPSGYPSLYYTTPPGIVSQVPPRPGL 389
            N+Y+KN++DDV DE+L+  F+  GTITSAKV +RDE+                                                    G +KGFGFVCFS+P+EA+KAV   +  M+  KPLYVA+AQRK+ R            Q  +Q Q  Q   GI      + P   P +Y   PPG   Q+P   G+
Sbjct:  333 NLYIKNLNDDVDDEKLRDMFTPFGTITSAKVILRDEEKKDEEEKEVKEEKKEDEKKEDEEAKEGSSSEQNGEDTKAGDKVTIKGEKKILGKSKGFGFVCFSNPDEATKAVTEMNQKMIEGKPLYVALAQRKDVRKNQLEATIQARNQLRMQQQQQQQFGGI--PQMFIAPGQQPMMY---PPGARGQMPFPAGM 521          

HSP 2 Score: 78.9518 bits (193), Expect = 6.694e-14
Identity = 40/89 (44.94%), Postives = 58/89 (65.17%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQY 269
            N+YVKNID DVTDE+ +  F + G ITSA + RD++G ++GFGFV +   E A+ AV+  +      + LYV  AQ+K +R+  L+ QY
Sbjct:  230 NIYVKNIDLDVTDEDFRELFEKHGDITSASIARDDQGKSRGFGFVNYIRHEAAAVAVDHLNDIEFKGQKLYVGRAQKKHEREEELRKQY 318          
The following BLAST results are available for this feature:
BLAST of DC900286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
PABP_CANGA2.295e-2243.80Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_LODEL5.114e-2241.38Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_NEOFI2.375e-1934.51Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_ASPFU4.052e-1934.21Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_NEUCR5.292e-1934.39Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_ASPTN1.179e-1834.10Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_COCIM2.626e-1835.05Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_ASPCL2.626e-1832.91Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_EMENI4.480e-1832.17Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_PHANO2.458e-1633.51Polyadenylate-binding protein, cytoplasmic and nuc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900286 VSS Citrus sinensis cDNA clone VS28632 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900286 ID=DC900286|Name=DC900286|organism=Citrus sinensis|type=EST|length=1248bp
CAAATGTTTATGTGAAGAACATTGATGATGATGTTACCGATGAAGAGCTA
AAAGCGCACTTCAGTCAGTGTGGCACAATTACTTCAGCAAAAGTGATGCG
AGATGAGAAAGGAATAAATAAGGGCTTTGGATTTGTGTGCTTCTCAAGCC
CAGAGGAGGCCAGTAAAGCTGTGAACACTTTCCATGGTTACATGTTACAC
CGCAAGCCATTGTACGTGGCTATTGCTCAAAGGAAGGAGGACAGACAAGC
ACATCTGCAACTTCAGTATGCACAGCATATGGCTGGAATAGAAGGAAGTT
CAGCTAATGTTATTCCCAGTGGATATCCTTCTCTTTACTACACAACTCCT
CCAGGTATTGTTTCACAAGTACCACCACGTCCTGGGCTGATGTACCAACC
TTTGGGTTTGAGGACGGGTTGGAGGGCCAATGGCTTTGTGCCACCAACCA
GACCAGCATTTCAAGTATCACCACTGCCAGTTAACCCAAAACACAATAGG
CAAAACAGAGGTAGGATGAATGGGAATATGCTTCCACAAGTAGGTGCTCA
CTATATGCAACAGTCCTCTCAATCTGCAGCTTCTTCAAAAGATTCAAGCA
ATCAACAGAAGGGTGGGCAAAGCAAGTATGTACCAAATGGTCGTACACGT
GAGTTAAACAAAGGATCTGGAGTCTCATTAGGTACTTTTAAATTCTGGTG
GAGTAATGGCGCGGAAACCAGATATGCTCAATGGTATGCTTGCCGCAGCT
TCCCCTGAGCAACAAAAACAGATACTTGGAGAGCGTCTGTACCCTCTTGT
CGAGAAACACAAGCCTGATCTTGTTGCCAAAATTACGGGAATGCTACTAC
AGATGGACAACTCGGAACTGCTGCTGTTATTGGAATCACCAGAGTCATTG
GCTGTAAAAGTGGAGGAAGCTGTGCAAGTGCTAAAGCTCTCAGAAGCCAA
AGTTTCAACTCAGGAAGCCATTCATCCCAATTACCTATCTGCTGAGGTTG
CAGTCAATTGAGAAGGCAAGCCCAAATTGTGCTGAAAAATATAGAGGTGC
TCACCAAATCGAAGAGGCCAAACTTGTTTTTGATACCATTAGCGAACATT
CATTTAGTTCATTTGTTTCTTTTTTTTTGTTTTTTTTTAACTGTTATTAG
AATCATTTTCTTTTTGGGTATAGGACATTGTTTCGTGTCTTTATTGAAGA
AGAAAGATTGATACTGTTGATCCTATGTTTATTTAACTGACAACTATT
back to top