DC900278

Overview
NameDC900278
Unique NameDC900278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1108
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5649 contig Csv1_Contig5649:1..1108. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: GSBP_CHICK (Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 8.781e-47
Identity = 112/297 (37.71%), Postives = 172/297 (57.91%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDGE-LTLDKIKTFGEDFLAGKVKPFFKS-DPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLK 873
            V F   +N DV   + +D +    A+V+ KK AE  + F+G+  K  + DF+  N LPLV  FT + AP +F   IK  +LLF   +  D +  L   ++AA  FKGK++FV++  D+ D  + + E+FG+  E  P V   T +++  K+  + E LT +K+  F   FL GK+KP   S +P+PE  D   VK++VG N++E+  DE K+V +E YAPWCGHC+   P +++L +  +  ++IVIAKM+ T NE    K   FPT+ FFPA  +    I+ + +RT+    KFL+
Sbjct:  182 VPFGINSNSDVYSKYQMDKD----AVVLFKKFAEGRNNFEGEITKEKLLDFIKHNNLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNLKKAADGFKGKILFVFIDSDHTD-NQRILEFFGLKKEECPAVRLITLDEELTKYKPETEELTAEKLTQFCHHFLEGKIKPHLMSNEPLPEDWDKQPVKVLVGKNYEEVAFDEKKNVFIEFYAPWCGHCKQLAPMWDRLGEAYKDDENIVIAKMESTANEVEAIKVHSFPTLKFFPASAER-TVIDYNGERTLDGYKKFLE 472          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_DROME (Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.040e-39
Identity = 107/323 (33.13%), Postives = 170/323 (52.63%), Query Frame = 1
Query:    7 FYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDS---EKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDGE-LTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAE 957
            F  ++N DV   +    E     +V+ K   +K S F+G+ ++  +  F     LPL+  F  E+A  +F   IK+ LL F VS +    EK +   +E AK ++  ++FV +  D ED  + + E+FG+  E  P +      +D  K+  + + L+ + I+ F + FL GK+K    S  +PE  D + VK++V +NF+ + LD+SK VL+E YAPWCGHC+   P Y++LA+  +  + IVIAKMD T NE    K   FPTI +F   +     I+ ++DRT+    KFL  N     ++       +TE+    PK +
Sbjct:  184 FGVSSNADVIAKY----EAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFF-VSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTR-IFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKV--IDFNLDRTLDDFVKFLDANG----EVADSEPVEETEEEEEAPKKD 494          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI1_SCHPO (Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe GN=SPAC1F5.02 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 7.451e-38
Identity = 101/294 (34.35%), Postives = 163/294 (55.44%), Query Frame = 1
Query:   64 NRPALVMVKKEAEKIS---YFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASI-PFKIQKPT-SAPKTE 930
            N P +V   K+A + S    + G +D ++IADF+  + +PL+    +       +S +   ++ +  +   ++L  VF+  AK ++  L F +  +D    G  V++   +  + P  +        K      ELT   +  F  DF+ GK++P  KS PIPE+ + D+ ++V +NFD+IV+DE+KDVL+E YAPWCGHC+   PTY KLA+      ++V+AK+D T N+   + S GFPTI+FF A +K  +P+  + DRT+  L  F+ K+AS  P K +K +  AP  E
Sbjct:  192 NFPGIVAFTKDAAQDSDKLVYTGDWDPASIADFIGVSSIPLLDELNQMTFGKYQQSGLPLGIIFYNSTESRDELYDVFQPLAKKYQDTLRFAF--LDAVRYGA-VAKQMNVESDWPAFVIANLKSMLKYPFPTTELTAKAMTKFVGDFVDGKLQPKIKSQPIPESQE-DLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDDSNVVVAKIDATENDISVSIS-GFPTIMFFKANDK-VNPVRYEGDRTLEDLSAFIDKHASFEPIKKEKESVPAPDLE 479          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA4_HUMAN (Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 1.405e-36
Identity = 110/314 (35.03%), Postives = 158/314 (50.32%), Query Frame = 1
Query:    7 FYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISY--------FDGKFDKSTIADFVFSNKLPLV---------TIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGE-LTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE--HHRAKSDGFPTILFFPAGNKSFDPINVD-VDRTVVALYKFLKKNAS 885
            F+ T + ++AK      +V++  LV+++ E  +  Y          G    S I DFV    LPLV           +TR     V+ S   +     A      K+L    E AK F     + +   D ED    V +  G++     V A   ++  KK  ++ E    D ++ F   F  GK+KP  KS P+P+ N G VK+VVG  FD IV+D  KDVL+E YAPWCGHC+  EP YN LAK  +G   +VIAKMD T N+    R K +GFPTI F P+G+K  +P+  +  DR +  L KF++++A+
Sbjct:  336 FHHTFSTEIAKFL----KVSQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVL----EVAKDFPE---YTFAIADEEDYAGEVKD-LGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKK-NPVKFEGGDRDLEHLSKFIEEHAT 636          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI2_DICDI (Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.190e-35
Identity = 100/336 (29.76%), Postives = 167/336 (49.70%), Query Frame = 1
Query:   31 VAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTL--DKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSD----GFPTILFFPAGNKSFDPINVDVDRT-VVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDEL 1017
            + K F  +   + P +V+ +   E      G+FD  ++  F+  N +PL+    R          +    L    + D+ ++L   ++ A S KG  +F +V M         + + G++G+    ++     +  ++  D + T   D +  + +D + GKV PF KS P PE+ND  VK+ VG  F ++VLD  KDVL+E YAPWCGHC+   P Y+KL ++L+ V+S+ I K+D  +N+     SD    G+PTI+ F A +K  +PI+ +  R   +   +F++ NA+I FK+               P +++ D   S + SS K   DEL
Sbjct:  202 IDKDFSKEHVESTPNVVLFRSFDEPTVAHKGEFDSESLIKFIKGNSVPLLGEINRNTYKKYESIAVPLAYLFIDSTQDNTQVLEDVKKIATSQKGNAVFCWVDMKKFP---QQATHMGLSGKVVPAISVDSVANKARYNFDEKETFSFDTVSKWIQDVIGGKVSPFVKSQPEPESNDAPVKVAVGTTFKKLVLDSPKDVLVEFYAPWCGHCKNLAPIYDKLGEYLKDVESVSIVKIDADSND---VPSDIEIRGYPTIMLFKADDKE-NPISYEGQRNDHMNFVEFIQDNAAIEFKL---------------PSSQTDDNVESKKDSSAK--HDEL 513          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA3_CHICK (Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 3.461e-35
Identity = 112/331 (33.84%), Postives = 160/331 (48.34%), Query Frame = 1
Query:    7 FYQTTNPDVAKIFHLDSE---VNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN-DSEKLLP--------VFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGI---TGEAPKVLAYTGNDDAKKHILDGELTLD--KIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE-HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASE 945
            F  T+   + + +  D E   + RP+ +  K E   + Y + K   + I  F+  N   +    T +N     +  I+ + LL A  + D EK           V   A K         +     +  G  +SE FG+    GEAP V   T   D  K ++  E + D   ++ F +D+  G +K + KS+P+PE NDG VK+VV  NFDEIV  E KDVL+E YAPWCGHC+  EP Y +L + L    +IVIAKMD T N+     +  GFPTI F PAG K   P   +  R V     +LK+ A+    +Q+   A K++K A E
Sbjct:  182 FAHTSEEQLVQKYEEDGEGVVLYRPSRLANKFEDSTVKYTEDKITSAKIKKFIQENIFGICPHMTEDN-----KDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMIAKKFLDAGHKLSFAVASRKTFGHELSE-FGLDNSVGEAPVVAIRTAKGD--KFVMQEEFSRDGKALERFLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFAPAGKKQ-SPKKYEGGREVSDFISYLKREATSTPVLQEEDKAKKSKKKAKE 503          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA4_MOUSE (Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 5.904e-35
Identity = 103/313 (32.91%), Postives = 157/313 (50.16%), Query Frame = 1
Query:    7 FYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISY--------FDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLI--------FVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGE-LTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNE--HHRAKSDGFPTILFFPAGNKSFDPINVD-VDRTVVALYKFLKKNAS 885
            F+ T +P++AK      +V+   LV+   E  +  Y          G  + S I D+V  + LPLV      N    +    K  L++   S D       +  A + ++ K++        + +   D ED    V +  G++     V A   ++  KK  ++ E    D ++ F   F  GK+KP  KS P+P+ N G VK+VVG  FD IV+D  KDVL+E YAPWCGHC+  EP Y  L K  +G   +VIAKMD T N+  + + K +GFPTI F P+G+K  +PI  +  +R +  L KF+ ++A+
Sbjct:  329 FHHTFSPEIAKFL----KVSLGKLVLTHPEKFQSKYEPRFHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSNDAKRYS---KRPLVVVYYSVDFSF---DYRAATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKD-LGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKK-NPIKFEGGNRDLEHLSKFIDEHAT 629          

HSP 2 Score: 68.5514 bits (166), Expect = 7.764e-11
Identity = 47/149 (31.54%), Postives = 69/149 (46.31%), Query Frame = 1
Query:  532 DPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVD-SIVIAKMDGTTNEHHRAKSD--GFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDI 969
            D +    +  V ++   NFD  V D+   VLLE YAPWCGHC+ F P Y K+A  L+  D  I +AK+D T+     +K D  G+PTI     G      ++ D  RT   +   ++       ++ +P   P  E   S  K    D+
Sbjct:   47 DDLEVKEENGVWVLNDGNFDNFVADKDT-VLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKG----QAVDYDGSRTQEEIVAKVR-------EVSQPDWTPPPEVTLSLTKDNFDDV 183          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_HUMIN (Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 7.711e-35
Identity = 101/313 (32.27%), Postives = 159/313 (50.80%), Query Frame = 1
Query:   61 VNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFG-ITGEAPKVLAYTGNDDAKKHIL----DGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKL-AKHLRG--VDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKN----ASIPFKIQKPTSAPKTEKPASEPKAESS 963
            V  PA+V+ K   E  + F  KF+   I  F  +   PL+     E       + I    +    + + ++L    +  A++ +G + F  +        K    + G +  +  K  A+   + AK        + E+T + IK F +DF+AGK++P  KS+PIPE  +G V +VV  N++EIVLD++KDVL+E YAPWCGHC+A  P Y +L A + +    D +VIAK+D T N+    +  GFPTI  +PAG K   P+     RTV  L KF+ +N    A+I    ++ +SA +T    +    E++
Sbjct:  191 VKAPAIVLYKDFDEGKAVFSEKFEVEAIEKFAKTGATPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTID------AKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATAND-VPDEIQGFPTIKLYPAGAKG-QPVTYSGSRTVEDLIKFIAENGKYKAAISEDAEETSSATETTTETATKSEEAA 495          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA2_HUMAN (Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 1.007e-34
Identity = 97/292 (33.22%), Postives = 147/292 (50.34%), Query Frame = 1
Query:  130 DKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDS--EKLLPVFEEAAKSFKGKLIFVYVQM--DNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKH--ILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIP-ETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHE 984
            D   ++ F+ ++ + LVT F  + +  +F + I N LLLF     +   +LL  F EAA  F+G+++FV V +  DNE V     +YFG+  EA   L     +  KK+  +  G +T   I  F    L G+VKP+  S  IP + +   VK +VG NF+++  DE+K+V ++ YAPWC HC+   P +  LA+  +  + I+IA++D T NE       GFPT+ +FPAG      I     R +    KFL     +      PT  P  E  A  P+  ++   GS E
Sbjct:  243 DLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHV----LQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAG-PGRKVIEYKSTRDLETFSKFLDNGGVL------PTEEPPEEPAAPFPEPPANSTMGSKE 523          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI_ASPOR (Protein disulfide-isomerase OS=Aspergillus oryzae GN=pdiA PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.243e-34
Identity = 105/345 (30.43%), Postives = 166/345 (48.12%), Query Frame = 1
Query:    7 FYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMD-----NEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEK---PASEPKAESSDIKGSHESSSXKDVKDEL 1017
            F  T++  +AK       V +P++V+ K   EK + +DG+ ++  +  +V +   PLV     E       + I    +      + E+    F+  A+  KG +  V +          ++    S++     + P+  A    D +K      E+    I  F +D L  KV+P  KS+ IPET +G V +VV +++ ++VLD  KDVLLE YAPWCGHC+A  P Y +LA   + +  + IAK+D T N+   + + GFPTI  F AG K   P+  +  RTV  L  F+K+N     K+      PK E+    A+E +A S + +    +S  K   DEL
Sbjct:  185 FAATSDASIAKA----EGVKQPSIVLYKDFDEKKATYDGEIEQDALLSWVKTASTPLVGELGPETYSGYITAGIPLAYIFAETKEEREQFTEEFKFIAEKHKGSINIVTIDAKLYGAHAGNLNLDPSKFPAFAIQDPEKNAKYPYDQSK------EVKAKDIGKFIQDVLDDKVEPSIKSEAIPETQEGPVTVVVAHSYKDLVLDNEKDVLLEFYAPWCGHCKALAPKYEELASLYKDIPEVTIAKIDATANDVPDSIT-GFPTIKLFAAGAKD-SPVEYEGSRTVEDLANFVKENGK--HKVDALEVDPKKEQESGDATETRAASDETETPAATSDDKSEHDEL 515          
The following BLAST results are available for this feature:
BLAST of DC900278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
GSBP_CHICK8.781e-4737.71Dolichyl-diphosphooligosaccharide--protein glycotr... [more]
PDI_DROME1.040e-3933.13Protein disulfide-isomerase OS=Drosophila melanoga... [more]
PDI1_SCHPO7.451e-3834.35Putative protein disulfide-isomerase C1F5.02 OS=Sc... [more]
PDIA4_HUMAN1.405e-3635.03Protein disulfide-isomerase A4 OS=Homo sapiens GN=... [more]
PDI2_DICDI1.190e-3529.76Protein disulfide-isomerase 2 OS=Dictyostelium dis... [more]
PDIA3_CHICK3.461e-3533.84Protein disulfide-isomerase A3 OS=Gallus gallus GN... [more]
PDIA4_MOUSE5.904e-3532.91Protein disulfide-isomerase A4 OS=Mus musculus GN=... [more]
PDI_HUMIN7.711e-3532.27Protein disulfide-isomerase OS=Humicola insolens P... [more]
PDIA2_HUMAN1.007e-3433.22Protein disulfide-isomerase A2 OS=Homo sapiens GN=... [more]
PDI_ASPOR2.243e-3430.43Protein disulfide-isomerase OS=Aspergillus oryzae ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900278 VSS Citrus sinensis cDNA clone VS28624 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900278 ID=DC900278|Name=DC900278|organism=Citrus sinensis|type=EST|length=1108bp
GTCAACTTCTATCAAACTACAAATCCTGATGTGGCAAAGATTTTCCACCT
TGATTCTGAAGTCAATCGCCCGGCTCTGGTCATGGTTAAGAAGGAGGCTG
AGAAAATAAGCTATTTTGATGGGAAATTTGATAAGTCTACTATTGCTGAT
TTTGTATTTTCAAACAAGCTTCCTTTAGTCACCATTTTTACAAGGGAAAA
TGCCCCTTCAGTTTTTGAAAGTCCAATTAAGAATCAGCTGCTATTGTTTG
CTGTTTCAAATGACTCAGAAAAGCTTTTACCAGTATTCGAAGAAGCCGCA
AAATCTTTCAAGGGAAAGCTTATTTTTGTGTATGTCCAAATGGACAATGA
AGATGTCGGAAAGCCTGTTTCAGAGTATTTTGGCATCACTGGGGAAGCTC
CCAAAGTTCTTGCATACACGGGGAATGATGACGCTAAAAAACATATCCTG
GATGGAGAGTTGACCTTGGATAAAATTAAGACTTTTGGAGAGGATTTCCT
CGCAGGCAAGGTTAAGCCTTTCTTTAAGTCTGATCCAATTCCAGAAACTA
ATGATGGAGATGTGAAAATAGTGGTTGGAAATAACTTTGATGAAATTGTC
TTGGATGAGTCAAAGGATGTTCTTCTGGAGATCTATGCCCCTTGGTGTGG
GCATTGCCAAGCCTTCGAGCCAACCTACAACAAACTGGCCAAACATCTAC
GTGGCGTTGATTCTATTGTTATCGCTAAGATGGATGGCACGACAAATGAA
CATCACAGGGCAAAGTCTGATGGATTCCCAACAATTCTTTTCTTCCCAGC
TGGAAACAAGAGTTTTGATCCTATCAATGTAGATGTTGACCGTACTGTGG
TGGCATTGTACAAGTTTCTTAAGAAAAATGCTTCAATCCCCTTTAAAATC
CAGAAGCCAACATCAGCACCCAAGACAGAGAAACCAGCTTCGGAACCAAA
AGCTGAGTCCTCGGATATCAAAGGGAGCCACGAGAGCAGTAGCGANAAAG
ATGTGAAGGACGAATTGTAACTTGCCTAAAACAAGGAAGATGATATACAA
CGGGTGTAATGCTAAANTTANTGTACACCTTTTATCAGTCATCAGGTACT
AGAAAGAA
back to top