DC900278

Overview
NameDC900278
Unique NameDC900278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1108
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5649 contig Csv1_Contig5649:1..1108. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA6_ARATH (Probable protein disulfide-isomerase A6 OS=Arabidopsis thaliana GN=At2g47470 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.254e-18
Identity = 60/187 (32.09%), Postives = 100/187 (53.48%), Query Frame = 1
Query:  268 EKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSD-----GFPTILFFPAGNKS 813
            +KL P +E+   SFK     +  ++D ++  K V   +G++G         G+ + +K+  +G    + +  +        VK       +P+    +V ++  +NFDEIVLD++KDVL+E YAPWCGHC++  PTY K+A   +  + +VIA +D    + H+A  +     GFPT+ FFP  NK+
Sbjct:   56 KKLAPEYEKLGASFKKAKSVLIAKVDCDEQ-KSVCTKYGVSGYPTIQWFPKGSLEPQKY--EGPRNAEALAEYVNKEGGTNVK----LAAVPQ----NVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDA---DAHKALGEKYGVSGFPTLKFFPKDNKA 228          

HSP 2 Score: 69.707 bits (169), Expect = 3.485e-11
Identity = 39/116 (33.62%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  559 DVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAK--SDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKI 900
            DV ++  ++F++ V  + K  L+E YAPWCGHC+   P Y KL    +   S++IAK+D    +    K    G+PTI +FP G  S +P   +  R   AL +++ K      K+
Sbjct:   24 DVVVLTDDSFEKEV-GKDKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKG--SLEPQKYEGPRNAEALAEYVNKEGGTNVKL 136          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI1_DICDI (Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 1.158e-14
Identity = 63/214 (29.44%), Postives = 102/214 (47.66%), Query Frame = 1
Query:  268 EKLLPVFEEAAKSF---KGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKS----DGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASI 888
            +KL P FE  A +F     K++   V  D  D  K +   + ++G  P +  +  +  AK +  +G  ++D++ T+  +     VK   K  P       +V  +  +NFD +VLD+SK+VL+E YAPWCGHC+   P Y  L         +VIAK+D    ++    S     GFPT+ +F  G +S D    +  R +     ++ K A +
Sbjct:   55 KKLAPDFEILADTFAPVSNKVVIAKVDCDQAD-NKALCSKYDVSGY-PTLKIFDKSTTAKDY--NGARSVDELLTYINNHAKTNVK--VKKAP------SNVVDLSPSNFDSVVLDKSKNVLVEFYAPWCGHCKKLMPDYEILGNTYANEKDVVIAKIDCDAADNKAICSKYGVTGFPTLKWF--GKQSKDGEKYEQGRDLDTFINYINKQAGV 254          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: ERP38_NEUCR (Protein disulfide-isomerase erp38 OS=Neurospora crassa GN=erp38 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 1.083e-12
Identity = 59/210 (28.10%), Postives = 93/210 (44.29%), Query Frame = 1
Query:  268 EKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPET-NDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSD----GFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNA 882
            + L PV+EE A + +     V +   + D  + + + FG+ G  P +  + G  +       G   LD +  F  +    K +    +  +    ND  +K  +G +         K+VL+   APWCGHC+   PT+ KLA        I IAK+D       ++ ++    GFPTI FFP G  S  P + +  R+   L KFL + A
Sbjct:   54 KNLAPVYEELATALEYAKDKVQIAKVDADAERALGKRFGVQG-FPTLKFFDGKSEQPVDYKGGR-DLDSLSNFIAEKTGVKARKKGSAPSLVNILNDATIKGAIGGD---------KNVLVAFTAPWCGHCKNLAPTWEKLAATFASDPEITIAKVDADAPTGKKSAAEYGVSGFPTIKFFPKG--STTPEDYNGGRSEADLVKFLNEKA 250          

HSP 2 Score: 73.559 bits (179), Expect = 2.414e-12
Identity = 43/120 (35.83%), Postives = 63/120 (52.50%), Query Frame = 1
Query:  571 VVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLR-GVDSIVIAKMDGTTNE--HHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAP 921
            ++ +NFD++VL   K  L+E +APWCGHC+   P Y +LA  L    D + IAK+D         R    GFPT+ FF    KS  P++    R + +L  F+ +   +  K +K  SAP
Sbjct:   25 LIPSNFDDVVLKSGKPTLVEFFAPWCGHCKNLAPVYEELATALEYAKDKVQIAKVDADAERALGKRFGVQGFPTLKFF--DGKSEQPVDYKGGRDLDSLSNFIAEKTGV--KARKKGSAP 140          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI2_SCHPO (Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe GN=SPAC17H9.14c PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.414e-12
Identity = 56/209 (26.79%), Postives = 95/209 (45.45%), Query Frame = 1
Query:  268 EKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTT----NEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNA 882
            + L PV+EE    F+     +  ++D  D    V++ + ITG     L +   D ++         +D +  F  +    K +       + E +          NFD++V+D+ KDVL+E YA WCG+C+   PTY  L K  +   ++ I K++          H   S  FPTI FFP  +K   P   + DR++ +L +++ K +
Sbjct:   55 KSLAPVYEELGALFEDHNDVLIGKID-ADTHSDVADKYHITGFP--TLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGIKKRKIVLPSNVVELDS--------LNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTYETLGKVFKNEPNVEIVKINADVFADIGRLHEVAS--FPTIKFFPKDDKD-KPELYEGDRSLESLIEYINKKS 249          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: TIGA_ASPNG (Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.764e-11
Identity = 55/191 (28.80%), Postives = 85/191 (44.50%), Query Frame = 1
Query:  268 EKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLAGKVK-PFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKS-----DGFPTILFFPAGNKSFDP 822
            + L PV+EE  ++F      V V   + D  + +   FG+ G  P +  + G  D  +    G   L+ + +F  +    K + P  +   +   ND   K  VG +          DVL+   APWCGHC+   PT+  LA       ++VIAK+D    E+ +A +      G+PTI FFP G+    P
Sbjct:   53 KNLAPVYEELGQAFAHASDKVTVGKVDADEHRDLGRKFGVQG-FPTLKWFDGKSDEPEDYKGGR-DLESLSSFISEKTGVKPRGPKKEPSKVEMLNDATFKGAVGGD---------NDVLVAFTAPWCGHCKNLAPTWEALANDFVLEPNVVIAKVDADA-ENGKATAREQGVSGYPTIKFFPKGSTESVP 231          
The following BLAST results are available for this feature:
BLAST of DC900278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
PDIA6_ARATH2.254e-1832.09Probable protein disulfide-isomerase A6 OS=Arabido... [more]
PDI1_DICDI1.158e-1429.44Protein disulfide-isomerase 1 OS=Dictyostelium dis... [more]
ERP38_NEUCR1.083e-1228.10Protein disulfide-isomerase erp38 OS=Neurospora cr... [more]
PDI2_SCHPO2.414e-1226.79Protein disulfide-isomerase C17H9.14c OS=Schizosac... [more]
TIGA_ASPNG7.764e-1128.80Protein disulfide-isomerase tigA OS=Aspergillus ni... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900278 VSS Citrus sinensis cDNA clone VS28624 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900278 ID=DC900278|Name=DC900278|organism=Citrus sinensis|type=EST|length=1108bp
GTCAACTTCTATCAAACTACAAATCCTGATGTGGCAAAGATTTTCCACCT
TGATTCTGAAGTCAATCGCCCGGCTCTGGTCATGGTTAAGAAGGAGGCTG
AGAAAATAAGCTATTTTGATGGGAAATTTGATAAGTCTACTATTGCTGAT
TTTGTATTTTCAAACAAGCTTCCTTTAGTCACCATTTTTACAAGGGAAAA
TGCCCCTTCAGTTTTTGAAAGTCCAATTAAGAATCAGCTGCTATTGTTTG
CTGTTTCAAATGACTCAGAAAAGCTTTTACCAGTATTCGAAGAAGCCGCA
AAATCTTTCAAGGGAAAGCTTATTTTTGTGTATGTCCAAATGGACAATGA
AGATGTCGGAAAGCCTGTTTCAGAGTATTTTGGCATCACTGGGGAAGCTC
CCAAAGTTCTTGCATACACGGGGAATGATGACGCTAAAAAACATATCCTG
GATGGAGAGTTGACCTTGGATAAAATTAAGACTTTTGGAGAGGATTTCCT
CGCAGGCAAGGTTAAGCCTTTCTTTAAGTCTGATCCAATTCCAGAAACTA
ATGATGGAGATGTGAAAATAGTGGTTGGAAATAACTTTGATGAAATTGTC
TTGGATGAGTCAAAGGATGTTCTTCTGGAGATCTATGCCCCTTGGTGTGG
GCATTGCCAAGCCTTCGAGCCAACCTACAACAAACTGGCCAAACATCTAC
GTGGCGTTGATTCTATTGTTATCGCTAAGATGGATGGCACGACAAATGAA
CATCACAGGGCAAAGTCTGATGGATTCCCAACAATTCTTTTCTTCCCAGC
TGGAAACAAGAGTTTTGATCCTATCAATGTAGATGTTGACCGTACTGTGG
TGGCATTGTACAAGTTTCTTAAGAAAAATGCTTCAATCCCCTTTAAAATC
CAGAAGCCAACATCAGCACCCAAGACAGAGAAACCAGCTTCGGAACCAAA
AGCTGAGTCCTCGGATATCAAAGGGAGCCACGAGAGCAGTAGCGANAAAG
ATGTGAAGGACGAATTGTAACTTGCCTAAAACAAGGAAGATGATATACAA
CGGGTGTAATGCTAAANTTANTGTACACCTTTTATCAGTCATCAGGTACT
AGAAAGAA
back to top