DC900274

Overview
NameDC900274
Unique NameDC900274
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length779
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODO2_RICFE (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia felis GN=sucB PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.645e-11
Identity = 43/105 (40.95%), Postives = 56/105 (53.33%), Query Frame = 3
Query:   36 TVAQKPXH-QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            T+A+K    +L   D  GGT     GG +G      IINPPQSGIL +   E+R +   G  + +    M + LS DHR+IDG  G  +L   K  IENPE +LL
Sbjct:  297 TLAKKAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDG--KIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKELIENPEKLLL 399          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODO2_RICCN (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Rickettsia conorii GN=sucB PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.512e-11
Identity = 40/96 (41.67%), Postives = 51/96 (53.12%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L   D  GGT     GG +G      IINPPQSGIL +   E+R +   G  + +    M + LS DHR+IDG  G  +L   K  IENPE +LL
Sbjct:  300 KLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDG--KIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLL 393          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODPX_MOUSE (Pyruvate dehydrogenase protein X component, mitochondrial OS=Mus musculus GN=Pdhx PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 7.696e-11
Identity = 37/94 (39.36%), Postives = 54/94 (57.45%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAE---KRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENP 332
            +L P++Y+GG+      G FGI +F A+INPPQ+ ILAVG      K      G  Q +    ++VT+S D RV+D  +   +L+ FK  +ENP
Sbjct:  404 KLMPEEYQGGSFSISNLGMFGIDEFAAVINPPQACILAVGRFRPVLKLTEDEEGNPQLQQHQLITVTMSSDSRVVDDELATRFLETFKANLENP 497          
The following BLAST results are available for this feature:
BLAST of DC900274 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
ODO2_RICFE2.645e-1140.95Dihydrolipoyllysine-residue succinyltransferase co... [more]
ODO2_RICCN4.512e-1141.67Dihydrolipoyllysine-residue succinyltransferase co... [more]
ODPX_MOUSE7.696e-1139.36Pyruvate dehydrogenase protein X component, mitoch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900274 VSS Citrus sinensis cDNA clone VS28618 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900274 ID=DC900274|Name=DC900274|organism=Citrus sinensis|type=EST|length=779bp
AGCTACAAAAAGGCTATCCCAATGCTAANAGTCAGACAGTGGCCCAAAAG
CCAAGNCACCAGCTTGAACCCCAAGATTATGAGGGAGGCACATCNCAGTA
CCAATTGGGAGGACCCTTCGGCATCAAGCAATTCTGTGCCATTATCAATC
CTCCTCAATCTGGCATTCTTGCAGTTGGATCTGCTGAGAAAAGGGTTATC
CCTGGCTTGGGTCCAGATCAGTATAAATTTTCTTCCTTCATGTCAGTAAC
ATTAAGTTGTGATCATCGCGTAATAGATGGTGCGATTGGTGCTGAATGGT
TGAAAGCATTCAAAGGATACATTGAGAATCCGGAGTCCATGTTGCTATAA
GCCAAACTTGTCTTTTTCTAAGTTGAGAAGCTCTTTCCTAGCTGTATCAG
TTTAGATGGGGGCTTCAGTTCAACCCCTTCCACCTGGGATCAGATTGGCA
TGGTTGTGTCACTGAGCACATCTTGATTTTGTTTTTCAATTGGTAAACAC
TTTTAAGCAAAAATTTTGGAATAAAAGCAGGGGATCGAGGCACGAAACCA
ATCCTTAAACTCATACTCATCCTTGATAGGGTGTTCAACAAGGTGNTCTG
CTATCGCCGTTTCCTTAATGGATTTTTGGGTTACATACGTGATGAACATG
ATTTTAGTAGAGTGTAATCGCCTCTTTCATGCGGGTAATAATTTGATTTA
TATATAATTTTTGGATTTTCCAATTACCAGTGTTGTGTGAAACAACACTT
ATATTAATTTGATAAACCTGTATTCTTGT
back to top