DC900273

Overview
NameDC900273
Unique NameDC900273
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length757
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_RHIME (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rhizobium meliloti GN=pdhC PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.871e-31
Identity = 82/186 (44.09%), Postives = 115/186 (61.83%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYL---ASRGKEVPAKAP------KG--KDVVAPALD---YVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGK---RISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            R+F+SP+AR LA+E  + LS I G+GP+G +VK D+E  +   A++    PA AP      KG  +D V    +   Y  +PH  +RK  A RL+ SKQTIPH+Y++VD  +D LM LR QLN+      GK   ++SVND+VIKA ALALR VP  N SW D+ + + K+ ++ VAV    GL++
Sbjct:  140 RIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVSGGAAKPAGAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTIPHFYVSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSWTDQNMVKHKHADVGVAVSIPGGLIT 325          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_RICPR (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia prowazekii GN=pdhC PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.898e-31
Identity = 70/170 (41.18%), Postives = 109/170 (64.12%), Query Frame = 3
Query:  204 DRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            +++FASP+A+ LA+  ++ L  ++G+GP+G IVK DI  Y +S            K V     +Y  +P++ IRKI A RLL SKQT+PH+YL+++  VD L+ +R  +N         +ISVND +I A A AL++VP  N+SW+++ IR + NV+I+VAV  ENG+++
Sbjct:  125 NKIFASPLAKRLAKIGDIRLENVQGSGPHGRIVKQDILSYDSSTSSN--------KIVYRDTEEYRSVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDVREDINKSFSEDKVTKISVNDFIILAVAKALQEVPNANASWSEDAIRYYNNVDISVAVAIENGIVT 286          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_RICTY (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia typhi GN=pdhC PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.091e-30
Identity = 69/169 (40.83%), Postives = 106/169 (62.72%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            ++FASP+A+ LA+  N+ L  ++G+GP+G IVK DI  Y  S       +            +Y  +P++ IR+I A RLL SKQT+PH+YL+++  VD L+ +R  +N         +ISVND +I A A AL++VP  N+SWA++ IR + NV+I+VAV  ENG+++
Sbjct:  126 KIFASPLAKRLAKIRNIRLESVQGSGPHGRIVKQDILSYSPSTAYNRDTE------------EYRSVPNNNIRQIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFSEDKLTKISVNDFIILAVAKALQEVPNANASWAEDAIRYYNNVDISVAVAIENGIVT 282          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_CAEEL (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=F23B12.5 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 7.072e-30
Identity = 81/246 (32.93%), Postives = 126/246 (51.22%), Query Frame = 3
Query:    3 VGEVIAITVEEEEDIPKFKDYSPSVSDAGXXXXXXXXXXXXXXXXXXXXX------IXTXXXXXXXXXXXXXXDRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSI-QEASAGK--RISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            +G+++ I V+ E D+  FKD+    + +G                                             R+ ASP A+ LA E+ + LS + G+GP G I+ +D+    A        +A  G+D       Y DIP S +RK  A RL  SK TIPHYYLT +I +D L+ +R +LN +  + ++G+  +IS+ND +IKA+ALA ++VP  NS W D +IR+  +V+++VAV T  GL++
Sbjct:  145 IGKLLCIIVDNEADVAAFKDFKDDGASSGGSAPAAEKAPEPAKPAASSQPSPPAQMYQAPSVPKSAPIPHSSSGRVSASPFAKKLAAENGLDLSGVSGSGPGGRILASDLSQAPAKGATSTTTQAVSGQD-------YTDIPLSNMRKTIAKRLTESKSTIPHYYLTSEIQLDTLLQVREKLNGLLAKGTSGQATKISINDFIIKASALACQRVPEANSYWMDSFIRENHHVDVSVAVSTPAGLIT 383          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_YEAST (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae GN=PDA2 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.285e-27
Identity = 86/259 (33.20%), Postives = 126/259 (48.65%), Query Frame = 3
Query:    3 VGEVIAITVEEEEDIPKFKDYSPSVSDAGXXXXXXXXXXXXXXXXXXXXXIX-----TXXXXXXXXXXXXXXDRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKE----------VPAKAPKGKDV-VAPA----LDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWA--DEYIRQFKNVNINVAVQTENGLMS 713
            V + IA+ VE++ D+P FKD+   + D+G                            T               R+FASP+A+ +A E  +SL  + GTGP G I KADIE YL    K+           PA A        AP+      Y D+P S +R I   RLL S Q IP Y ++  I +  L+ LR  LN+   A+   ++S+NDL++KA  +A ++VP  N+ W   +  IR+FKNV+++VAV T  GL++
Sbjct:  102 VNKPIAVYVEDKADVPAFKDFK--LEDSGSDSKTSTKAQPAEPQAEKKQEAPAEETKTSAPEAKKSDVAAPQGRIFASPLAKTIALEKGISLKDVHGTGPRGRITKADIESYLEKSSKQSSQTSGAAAATPAAATSSTTAGSAPSPSSTASYEDVPISTMRSIIGERLLQSTQGIPSYIVSSKISISKLLKLRQSLNA--TANDKYKLSINDLLVKAITVAAKRVPDANAYWLPNENVIRKFKNVDVSVAVATPTGLLT 356          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_ZYMMO (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Zymomonas mobilis GN=pdhC PE=3 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 1.248e-26
Identity = 68/172 (39.53%), Postives = 105/172 (61.05%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGK---EVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            R+ ASP+A+ LA++++V L  + G+GP+G I+KADIE ++A   +         P+    +     +  I  S +R++ A RL  SKQ IPH YLTVD+ +D L+ LR++LN    A    +ISVND++IKA ALAL+  P  N ++  + + QF   +I+VAV  E GL++
Sbjct:  147 RIKASPLAKRLAKKNHVDLKQVNGSGPHGRIIKADIEAFIAEANQASSNPSVSTPEASGKITHDTPHNSIKLSNMRRVIARRLTESKQNIPHIYLTVDVQMDALLKLRSELNE-SLAVQNIKISVNDMLIKAQALALKATPNVNVAFDGDQMLQFSQADISVAVSVEGGLIT 317          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_NEUCR (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Neurospora crassa GN=mrp-3 PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 2.354e-25
Identity = 68/166 (40.96%), Postives = 97/166 (58.43%), Query Frame = 3
Query:  216 ASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            A P A+ LA E  + L  +KG+GP G I + D++  LAS     PA         A A  Y D+P S +RK  A+RL  S    PH++++ ++ V  L+ LR  LNS   A    ++SVND +IKA  +A ++VP  NSSW D  IRQF+ V+++VAV T NGL++
Sbjct:  178 ALPAAKRLAREKGIDLRNVKGSGPGGKITEEDVKKALAS----APAAG-------AAAAAYTDVPISGMRKTIAARLKESVTENPHFFVSTNLSVSKLLKLRQALNS--SADGRYKLSVNDFLIKAMGIASKRVPTVNSSWRDGVIRQFETVDVSVAVATPNGLIT 330          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: OPD21_ARATH (Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=LTA3 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 1.993e-24
Identity = 73/183 (39.89%), Postives = 103/183 (56.28%), Query Frame = 3
Query:  219 SPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASR--------------GKEVPAKAPKGK--DVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEY--IRQFKNVNINVAVQTENGLMS 713
            SP A+ L  EH +  S I+ +GP G ++K+D+   +AS                KE P+K+       V     +Y D P+SQIRKI A RLL SKQ IPH YL  D+ +D L+  R +L    + + G ++SVND+VIKA A+ALR V + N+ W  E   I    +V+I++AV TE GLM+
Sbjct:  332 SPAAKLLILEHGLEASSIEASGPYGTLLKSDVVAAIASGKASKSSASTKKKQPSKETPSKSSSTSKPSVTQSDNNYEDFPNSQIRKIIAKRLLESKQKIPHLYLQSDVVLDPLLAFRKEL----QENHGVKVSVNDIVIKAVAVALRNVRQANAFWDAEKGDIVMCDSVDISIAVATEKGLMT 510          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODPX_MOUSE (Pyruvate dehydrogenase protein X component, mitochondrial OS=Mus musculus GN=Pdhx PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.755e-18
Identity = 64/200 (32.00%), Postives = 95/200 (47.50%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDY--LASRGK----------------EVPAKAPKGKDVVAP-------------ALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            R   SP ARN+ E+H++  S    TGP G+  K D      L   GK                 VP +A  G     P             A  + +IP S IR++ A RL  SK T+PH Y T D  +  ++ +R  L          ++SVND +I+AAA+ L+++P  N +W  E  +Q  +V+I+VAV T+ GL++
Sbjct:  181 RFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVELKQMGKITESRPASAPPPSLSASVPPQATAGPSYPRPMTPPVSIPGQPNAAGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRRDL-----VKDDIKVSVNDFIIRAAAVTLKQMPGVNVTWDGEGPKQLPSVDISVAVATDKGLIT 375          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODB2_BACSU (Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Bacillus subtilis GN=bfmBB PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.755e-18
Identity = 57/180 (31.67%), Postives = 90/180 (50.00%), Query Frame = 3
Query:  219 SPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRG------KEVPAKAPKGKDVVAP-----------ALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGL 707
            SP    LA EH + L  + GTG  G I + DI+  + + G      +E+   AP  K    P           A    +IP + +RK  AS +  SK  IPH +  +++ V N++  RN +    + + G  ++     +KA A AL++ P+ NS WA + I Q K++NI++AV TE+ L
Sbjct:  118 SPAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEELKTAAPAPKSASKPEPKEETSYPASAAGDKEIPVTGVRKAIASNMKRSKTEIPHAWTMMEVDVTNMVAYRNSIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDINISIAVATEDSL 297          
The following BLAST results are available for this feature:
BLAST of DC900273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
ODP2_RHIME2.871e-3144.09Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICPR4.898e-3141.18Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICTY1.091e-3040.83Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_CAEEL7.072e-3032.93Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_YEAST3.285e-2733.20Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_ZYMMO1.248e-2639.53Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_NEUCR2.354e-2540.96Dihydrolipoyllysine-residue acetyltransferase comp... [more]
OPD21_ARATH1.993e-2439.89Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODPX_MOUSE4.755e-1832.00Pyruvate dehydrogenase protein X component, mitoch... [more]
ODB2_BACSU4.755e-1831.67Lipoamide acyltransferase component of branched-ch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900273 VSS Citrus sinensis cDNA clone VS28618 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900273 ID=DC900273|Name=DC900273|organism=Citrus sinensis|type=EST|length=757bp
AAGTTGGTGAGGTTATTGCTATCACTGTTGAAGAAGAGGAAGATATTCCG
AAGTTTAAAGATTACAGTCCTTCAGTGTCTGATGCTGGTGCTGCTCCAGC
TAAAGAGCCTTCTCCTCCTCCCCCTCCAAAACAGGAAGAGGTTGAAAAAC
CAATCNGTACATCAGAGCCAAAGGCCTCTAAACCCAGTGCAGCTTCTCCT
GAAGATCGCCTTTTTGCTAGTCCTGTTGCTAGGAATTTGGCTGAAGAACA
TAATGTTTCCCTCTCCATCATCAAGGGAACAGGTCCCAATGGACTCATTG
TGAAGGCTGATATTGAAGATTACTTGGCTTCTCGTGGGAAAGAAGTTCCA
GCCAAAGCTCCTAAGGGTAAGGACGTTGTGGCCCCAGCTTTGGACTATGT
TGACATCCCTCATTCTCAAATAAGAAAGATCACTGCTTCACGCTTGTTGT
TCTCAAAGCAAACAATCCCACATTATTATTTAACAGTCGATATATGTGTT
GACAATCTCATGGGTTTGCGAAACCAACTCAATTCCATACAAGAGGCTTC
GGCTGGAAAGCGGATATCTGTTAATGATCTGGTGATTAAGGCTGCAGCCT
TGGCTCTGCGAAAAGTGCCTCGGTGCAATAGTTCATGGGCTGATGAATAT
ATCCGACAATTTAAGAATGTGAATATTAATGTAGCAGTGCAGACAGAAAA
CGGTCTTATGTCCCAGTTNTAAGGGATGCTGACAGAAAGGCTTATCCNCA
TTGCTGA
back to top