DC900273

Overview
NameDC900273
Unique NameDC900273
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length757
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODPX_HUMAN (Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens GN=PDHX PE=1 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 1.059e-17
Identity = 63/200 (31.50%), Postives = 93/200 (46.50%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIED--YLASRGK----------------EVPAKAPKGKDVVAPAL-------------DYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            R   SP ARN+ E+H++  S    TGP G+  K D      L   GK                  P +A  G     P +              + +IP S IR++ A RL  SK T+PH Y T D  +  ++ +R  L          ++SVND +IKAAA+ L+++P  N SW  E  +Q   ++I+VAV T+ GL++
Sbjct:  181 RFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDL-----VKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLT 375          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: Y1564_DICDI (Pyruvate dehydrogenase complex subunit homolog DDB_G0271564, mitochondrial OS=Dictyostelium discoideum GN=pdhX PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.807e-17
Identity = 61/211 (28.91%), Postives = 101/211 (47.87%), Query Frame = 3
Query:  204 DRLFASPVARNLAEEHNVSLSI-IKGTGPNGLIVKADIEDYLASRG---------------KEVPAKAPKGKDVVAPALD-----------------------YVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKN--VNINVAVQTENGLMS 713
            D  +  P  R L  E+ ++ S  +  TGP   ++K D+  Y+ ++                   P+ +     V +P L                        Y DIP++ IR++ A++L  SKQ +PH+Y+TV+  +DN++ +R  +          +ISVND V++A ALALR  P+ NS W+DE+     N  V+I+ AV T+ GL++
Sbjct:   26 DSEYMFPSVRRLLVEYGINSSKEVTATGPQNRLLKGDVLAYIKTKNLSPVDRLSLIASSVKSSQPSSSSSPSIVDSPTLTSQIKDQIKIVTTITNDKNKSKVIYEDIPNNNIRRVIATKLSQSKQQVPHFYMTVECELDNVLAMRKSM------PENVKISVNDFVLRACALALRDNPQANSKWSDEHGEAILNPTVDISFAVSTDRGLIT 230          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODPX_BOVIN (Pyruvate dehydrogenase protein X component OS=Bos taurus GN=PDHX PE=1 SV=3)

HSP 1 Score: 89.3521 bits (220), Expect = 2.360e-17
Identity = 61/196 (31.12%), Postives = 93/196 (47.45%), Query Frame = 3
Query:  219 SPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDY--LASRGK--------------------EVPAKAPKGKDVVAPALD---------YVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            SP ARN+ E+H +  +    TGP G+  K D      L   GK                    +  A A   + ++ P            + +IP S IR++ A RL  SK TIPH Y T D  +  ++  R  L          ++SVND +IKAAA+ L+++P  N+SW  E  +Q  +++I+VAV T+ GL++
Sbjct:  185 SPAARNILEKHALDANQGTATGPRGIFTKEDALKLVQLKQTGKITEPRPTAALPTTPAAPLPPQAAATASYPRPMIPPVSTPGQPNVEGTFTEIPASNIRRVIAKRLTESKSTIPHAYATTDCDLGAVLTARQNL-----VRDDIKVSVNDFIIKAAAVTLKQMPNVNASWDGEGAKQLPSIDISVAVATDRGLIT 375          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ACOC_BACSU (Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Bacillus subtilis GN=acoC PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.998e-16
Identity = 56/169 (33.14%), Postives = 89/169 (52.66%), Query Frame = 3
Query:  204 DRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLM 710
            DR+  SPVAR +AE+  + L  +KGTGP G IVK D+   LA + K+      + K          +IP + +RK+ A+R+  S        +T+   +  L  L+ QL+   E   G ++++   V +AA LAL+  P  NS + +E I    +V++ +AV  ENGL+
Sbjct:  115 DRMKISPVARKIAEKAGLDLKQLKGTGPGGRIVKDDVTKALAEQKKDQAKPVSEQKAQ--------EIPVTGMRKVIAARMQESLANSAQLTITMKADITKLATLQKQLSPTAEERYGTKLTITHFVSRAAVLALQAHPVLNSFYQNERIITHPHVHLGMAVALENGLV 275          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_BACST (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Bacillus stearothermophilus GN=pdhC PE=1 SV=3)

HSP 1 Score: 82.4185 bits (202), Expect = 2.885e-15
Identity = 60/177 (33.90%), Postives = 87/177 (49.15%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVA--PALDYVDIPH-----SQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWAD--EYIRQFKNVNINVAVQTENGLM 710
            R+ A P  R  A E  V + +++GTG NG ++K DI+ +LA   K  PA A +     A  PA    + P      S IR+  A  ++ SK T PH  L  +  V  L+  R +  +I  A  G +++    V+KA   ALR+ P  N+S  D  E I Q    NI +A  T+ GL+
Sbjct:  128 RVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHRKKFKAI-AAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLL 303          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_ACHLA (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Acholeplasma laidlawii GN=pdhC PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.442e-14
Identity = 56/184 (30.43%), Postives = 96/184 (52.17%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAK------------APKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSW---ADE-YIRQFKNVNINVAVQTENGLM 710
            ++ ASPVAR LA +  V ++ IKG+G  G ++K D+++  A    + P +            AP       P  D   +  +++RK  ++ +  SK  IP   L  +I VD L+  RN+   + E S G +++    + KA  +AL++ P  N+S+    DE YI++F  +N+ +AV T +GL+
Sbjct:  240 KVLASPVARKLASDLGVDIATIKGSGEQGRVMKDDVQNSKAPAEAQAPVQQTQAPAQAAASVAPSFAAAGKPQGDVEVVKITRLRKAVSNAMTRSKSIIPETVLMDEINVDALVNFRNEAKGLAE-SKGIKLTYMAFIAKAVLIALKEFPMFNASFNHDTDEVYIKKF--INLGMAVDTPDGLI 420          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODB2_PSEAE (Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Pseudomonas aeruginosa GN=bkdB PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.189e-14
Identity = 49/171 (28.65%), Postives = 89/171 (52.05%), Query Frame = 3
Query:  204 DRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWAD--EYIRQFKNVNINVAVQTENGLM 710
            +R  ASP  R  A +  + L  ++G+GP G ++  D++ YL   G    A++       A   D   +P   +R+  A ++  +K+ IPH+    +I V +L  LR  LN       GK +++   +++A  +ALR  P+ N+ + D  E + ++  V++ +A Q++NGLM
Sbjct:  137 ERPLASPAVRQRARDLGIELQFVQGSGPAGRVLHEDLDAYLTQDGS--VARSGGAAQGYAERHDEQAVPVIGLRRKIAQKMQDAKRRIPHFSYVEEIDVTDLEALRAHLNQKWGGQRGK-LTLLPFLVRAMVVALRDFPQLNARYDDEAEVVTRYGAVHVGIATQSDNGLM 304          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODB2_PSEPU (Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex OS=Pseudomonas putida GN=bkdB PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.165e-14
Identity = 52/171 (30.41%), Postives = 90/171 (52.63%), Query Frame = 3
Query:  204 DRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADE--YIRQFKNVNINVAVQTENGLM 710
            D+  ASP  R  A +  + L  + G+GP G I+  D++ ++ S+ +    + P G    A   D   +P   +R+  A R+  +K+ + H+    +I V  L  LR QLNS    S GK +++   +++A  +ALR  P+ N+++ DE   I +   V++ +A Q +NGLM
Sbjct:  134 DKPLASPAVRKRALDAGIELRYVHGSGPAGRILHEDLDAFM-SKPQSAAGQTPNG---YARRTDSEQVPVIGLRRKIAQRMQDAKRRVAHFSYVEEIDVTALEALRQQLNSKHGDSRGK-LTLLPFLVRALVVALRDFPQINATYDDEAQIITRHGAVHVGIATQGDNGLM 299          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_MYCCT (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=pdhC PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.105e-14
Identity = 53/184 (28.80%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  216 ASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASR--------GKEVPAKAPKGKDVVAPALDYV---------DIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCN--SSWADEYIRQFKNVNINVAVQTENGLM 710
            A+P+AR +A + N+ LS++  TGPN  I+ ADI+++ AS          +  P  +P     +AP +  V         ++P + +RK T   +  S   I  +    +  +     +R +L     A++G +++    +IKA A +LR +P  N    +A+  I+   N+NI +AV T NGLM
Sbjct:  133 ATPLARKVAADLNIDLSLVTPTGPNQRILVADIKNHQASSTQLASQPISQPAPTPSPSAHQTIAPTIKVVEPSAPLSWDEVPMNGVRKATVKAMTKSHTEIAAFTGMKNTDITETHKMRTELKD-HAAASGIKLTYLAFIIKAVAKSLRDMPNINVRGDFANNKIQFMHNINIGIAVDTPNGLM 315          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_BACSU (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Bacillus subtilis GN=pdhC PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.700e-13
Identity = 59/181 (32.60%), Postives = 88/181 (48.62%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAK---APK---GKDVVAPALDYVDIPH-----SQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWAD--EYIRQFKNVNINVAVQTENGLM 710
            R+ A P  R  A E  V +  + G+G NG +VK DI+ ++    +E   +   AP+    K   APA +  + P      S IRK  A  ++ SK T PH  L  ++ V NL+  R Q   +  A  G +++    V+KA   AL+K P  N+S  D  + + Q    NI +A  TE GL+
Sbjct:  139 RVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNGGAQEAAPQETAAPQETAAKPAAAPAPE-GEFPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTNLVAHRKQFKQV-AADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEVIQKHYFNIGIAADTEKGLL 317          
The following BLAST results are available for this feature:
BLAST of DC900273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
ODPX_HUMAN1.059e-1731.50Pyruvate dehydrogenase protein X component, mitoch... [more]
Y1564_DICDI1.807e-1728.91Pyruvate dehydrogenase complex subunit homolog DDB... [more]
ODPX_BOVIN2.360e-1731.12Pyruvate dehydrogenase protein X component OS=Bos ... [more]
ACOC_BACSU1.998e-1633.14Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_BACST2.885e-1533.90Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_ACHLA2.442e-1430.43Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODB2_PSEAE3.189e-1428.65Lipoamide acyltransferase component of branched-ch... [more]
ODB2_PSEPU4.165e-1430.41Lipoamide acyltransferase component of branched-ch... [more]
ODP2_MYCCT7.105e-1428.80Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_BACSU2.700e-1332.60Dihydrolipoyllysine-residue acetyltransferase comp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900273 VSS Citrus sinensis cDNA clone VS28618 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900273 ID=DC900273|Name=DC900273|organism=Citrus sinensis|type=EST|length=757bp
AAGTTGGTGAGGTTATTGCTATCACTGTTGAAGAAGAGGAAGATATTCCG
AAGTTTAAAGATTACAGTCCTTCAGTGTCTGATGCTGGTGCTGCTCCAGC
TAAAGAGCCTTCTCCTCCTCCCCCTCCAAAACAGGAAGAGGTTGAAAAAC
CAATCNGTACATCAGAGCCAAAGGCCTCTAAACCCAGTGCAGCTTCTCCT
GAAGATCGCCTTTTTGCTAGTCCTGTTGCTAGGAATTTGGCTGAAGAACA
TAATGTTTCCCTCTCCATCATCAAGGGAACAGGTCCCAATGGACTCATTG
TGAAGGCTGATATTGAAGATTACTTGGCTTCTCGTGGGAAAGAAGTTCCA
GCCAAAGCTCCTAAGGGTAAGGACGTTGTGGCCCCAGCTTTGGACTATGT
TGACATCCCTCATTCTCAAATAAGAAAGATCACTGCTTCACGCTTGTTGT
TCTCAAAGCAAACAATCCCACATTATTATTTAACAGTCGATATATGTGTT
GACAATCTCATGGGTTTGCGAAACCAACTCAATTCCATACAAGAGGCTTC
GGCTGGAAAGCGGATATCTGTTAATGATCTGGTGATTAAGGCTGCAGCCT
TGGCTCTGCGAAAAGTGCCTCGGTGCAATAGTTCATGGGCTGATGAATAT
ATCCGACAATTTAAGAATGTGAATATTAATGTAGCAGTGCAGACAGAAAA
CGGTCTTATGTCCCAGTTNTAAGGGATGCTGACAGAAAGGCTTATCCNCA
TTGCTGA
back to top