DC900273

Overview
NameDC900273
Unique NameDC900273
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length757
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODO2_ECOLI (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli (strain K12) GN=sucB PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.700e-13
Identity = 49/167 (29.34%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  219 SPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRG--KEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            SP  R L  EHN+  S IKGTG  G + + D+E +LA     +  PA A         A     +P +++RK  A RLL +K +        ++ +  +M LR Q     E   G R+      +KA   AL++ P  N+S   + +      ++++AV T  GL++
Sbjct:  115 SPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAAAPAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVT 281          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODO2_ECO57 (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli O157:H7 GN=sucB PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.700e-13
Identity = 49/167 (29.34%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  219 SPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRG--KEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            SP  R L  EHN+  S IKGTG  G + + D+E +LA     +  PA A         A     +P +++RK  A RLL +K +        ++ +  +M LR Q     E   G R+      +KA   AL++ P  N+S   + +      ++++AV T  GL++
Sbjct:  115 SPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAAAPAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVT 281          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_HAEIN (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Haemophilus influenzae GN=aceF PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.015e-13
Identity = 64/186 (34.41%), Postives = 92/186 (49.46%), Query Frame = 3
Query:  216 ASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYL--ASRGKEVPAKAPKGKDVVA----------PALDY------VDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQE-ASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQF--KNVNINVAVQTENGLM 710
            A+PV R LA E  V+L  +KGTG  G IVK DIE Y+  A +  E  A A    + VA          P +D+       ++  S+I KI+ + L  +   IPH        + +L   R + N+++E    G +I+    ++KA A AL   PR NSS  ++  R    K +NI VAV T NGL+
Sbjct:  259 ATPVIRRLAREFGVNLDKVKGTGRKGRIVKEDIEAYVKTAVKAYESGATAQATGNGVANGAGLGLLPWPKVDFSKFGEIEEVELSRINKISGANLHRNWVIIPHVTHFDKADITDLEAFRKEQNALREKQKLGVKITPVVFIMKAVAKALEAYPRFNSSITEDAQRLILKKYINIGVAVDTPNGLV 444          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_ECOLI (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Escherichia coli (strain K12) GN=aceF PE=1 SV=3)

HSP 1 Score: 71.633 bits (174), Expect = 5.092e-12
Identity = 57/181 (31.49%), Postives = 92/181 (50.83%), Query Frame = 3
Query:  216 ASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYL-----------ASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGK---RISVNDLVIKAAALALRKVPRCNSSWADEYIRQF--KNVNINVAVQTENGLM 710
            A+P+ R LA E  V+L+ +KGTG  G I++ D++ Y+           A+ G  +P   P  K   +   +  ++   +I+KI+ + L  +   IPH        +  L   R Q N  +EA+  K   +I+    ++KA A AL ++PR NSS +++  R    K +NI VAV T NGL+
Sbjct:  329 ATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQN--EEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLV 507          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_STAEQ (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdhC PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.481e-11
Identity = 57/181 (31.49%), Postives = 81/181 (44.75%), Query Frame = 3
Query:  216 ASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKE-----VPAKAPKGKDVV----APALDYVDIPHS-----QIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADE--YIRQFKNVNINVAVQTENGLM 710
            A P  R  A E+ V++  + G+G NG I K DI+ YL     E       A      DVV      AL   D P +      +RK  A  ++ SK T PH  L  +I V  L   R +   I  A  G +++    V+KA   AL+K P  N+S+ +E   +      NI +A  T+ GL+
Sbjct:  129 AMPSVRKYARENGVNIKAVNGSGKNGRITKEDIDAYLNGGSSEEGSNTSAASESTSSDVVNASATQALPEGDFPETTEKIPAMRKAIAKAMVNSKHTAPHVTLMDEIDVQELWDHRKKFKEI-AAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVHKHYWNIGIAADTDKGLL 308          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_STAES (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdhC PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.935e-11
Identity = 57/181 (31.49%), Postives = 81/181 (44.75%), Query Frame = 3
Query:  216 ASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKE-----VPAKAPKGKDVV----APALDYVDIPHS-----QIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADE--YIRQFKNVNINVAVQTENGLM 710
            A P  R  A E+ V++  + G+G NG I K DI+ YL     E       A      DVV      AL   D P +      +RK  A  ++ SK T PH  L  +I V  L   R +   I  A  G +++    V+KA   AL+K P  N+S+ +E   +      NI +A  T+ GL+
Sbjct:  129 AMPSVRKYARENGVNIKAVNGSGKNGRITKEDIDAYLNGGSSEEGSNTSVASESTSSDVVNASATQALPEGDFPETTEKIPAMRKAIAKAMVNSKHTAPHVTLMDEIDVQELWDHRKKFKEI-AAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVHKHYWNIGIAADTDKGLL 308          
The following BLAST results are available for this feature:
BLAST of DC900273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
ODO2_ECOLI2.700e-1329.34Dihydrolipoyllysine-residue succinyltransferase co... [more]
ODO2_ECO572.700e-1329.34Dihydrolipoyllysine-residue succinyltransferase co... [more]
ODP2_HAEIN6.015e-1334.41Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_ECOLI5.092e-1231.49Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_STAEQ1.481e-1131.49Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_STAES1.935e-1131.49Dihydrolipoyllysine-residue acetyltransferase comp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900273 VSS Citrus sinensis cDNA clone VS28618 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900273 ID=DC900273|Name=DC900273|organism=Citrus sinensis|type=EST|length=757bp
AAGTTGGTGAGGTTATTGCTATCACTGTTGAAGAAGAGGAAGATATTCCG
AAGTTTAAAGATTACAGTCCTTCAGTGTCTGATGCTGGTGCTGCTCCAGC
TAAAGAGCCTTCTCCTCCTCCCCCTCCAAAACAGGAAGAGGTTGAAAAAC
CAATCNGTACATCAGAGCCAAAGGCCTCTAAACCCAGTGCAGCTTCTCCT
GAAGATCGCCTTTTTGCTAGTCCTGTTGCTAGGAATTTGGCTGAAGAACA
TAATGTTTCCCTCTCCATCATCAAGGGAACAGGTCCCAATGGACTCATTG
TGAAGGCTGATATTGAAGATTACTTGGCTTCTCGTGGGAAAGAAGTTCCA
GCCAAAGCTCCTAAGGGTAAGGACGTTGTGGCCCCAGCTTTGGACTATGT
TGACATCCCTCATTCTCAAATAAGAAAGATCACTGCTTCACGCTTGTTGT
TCTCAAAGCAAACAATCCCACATTATTATTTAACAGTCGATATATGTGTT
GACAATCTCATGGGTTTGCGAAACCAACTCAATTCCATACAAGAGGCTTC
GGCTGGAAAGCGGATATCTGTTAATGATCTGGTGATTAAGGCTGCAGCCT
TGGCTCTGCGAAAAGTGCCTCGGTGCAATAGTTCATGGGCTGATGAATAT
ATCCGACAATTTAAGAATGTGAATATTAATGTAGCAGTGCAGACAGAAAA
CGGTCTTATGTCCCAGTTNTAAGGGATGCTGACAGAAAGGCTTATCCNCA
TTGCTGA
back to top