DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNE7 (Elongation factor Tu OS=Synechococcus elongatus (strain PCC 7942) GN=tuf PE=3 SV=2)

HSP 1 Score: 244.588 bits (623), Expect = 5.654e-64
Identity = 115/158 (72.78%), Postives = 138/158 (87.34%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VGL++TR+ TVTGVEMFQKTLDE +AGDNVGLLLRG+QK DI+RGMVLAKPG+ITPHTKF + VYVLKKEEGGRH+PFF GYRPQFY+RTTDVTG +S    D    ++MV+PGDRIKM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  252 TIEIVGLRDTRSTTVTGVEMFQKTLDEGLAGDNVGLLLRGIQKTDIERGMVLAKPGSITPHTKFESEVYVLKKEEGGRHTPFFPGYRPQFYVRTTDVTGAISDFTADDGSAAEMVIPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILQ 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNJB (Elongation factor Tu OS=Synechococcus sp. GN=tuf PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.645e-64
Identity = 116/158 (73.42%), Postives = 138/158 (87.34%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+LVGL+ETR+ TVTG+EMFQKTLDE +AGDNVG+LLRG+QK +++RGMVLAKP TITPHT F + VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG +SS   D   + +MVMPGDR+KM VELI P+A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  252 TVELVGLRETRSTTVTGLEMFQKTLDEGIAGDNVGVLLRGIQKNEVERGMVLAKPKTITPHTNFESEVYVLKKEEGGRHTPFFAGYRPQFYVRTTDVTGTISSFTADDGSQPEMVMPGDRVKMTVELIQPIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_OSTTA (Elongation factor Tu, chloroplastic OS=Ostreococcus tauri GN=tufA PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.645e-64
Identity = 113/158 (71.52%), Postives = 142/158 (89.87%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++++G  +TR  TVTG+EMFQKTL+E++AGDNVG+LLRG+QK DI+RGMVLA+PGTITPHTKF A VYVLKKEEGGRH+PFF GYRPQFY+RTTDVTG++ S ++D+ +E+ MVMPGDR+KMVVELI P+A E GMRFAIREGG+TVGAGV+ SI++
Sbjct:  252 SIEIIGYVDTRVATVTGLEMFQKTLEESVAGDNVGVLLRGIQKEDIERGMVLAQPGTITPHTKFEAQVYVLKKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFISDEGDEATMVMPGDRVKMVVELIQPIAIENGMRFAIREGGRTVGAGVVSSILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_EUGGR (Elongation factor Tu, chloroplastic OS=Euglena gracilis GN=tufA PE=1 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.645e-64
Identity = 115/158 (72.78%), Postives = 140/158 (88.61%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+LVGLK+TR+ T+TG+EMFQK+LDEA+AGDNVG+LLRG+QK D++RGMVLAKP TI PHTKF + VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG++ S  +D D  ++MVMPGDRIKM VELI P+A E+GMRFAIREGG+TVGAGV+ SII+
Sbjct:  252 TVELVGLKDTRSTTITGLEMFQKSLDEALAGDNVGVLLRGIQKNDVERGMVLAKPRTINPHTKFDSQVYILTKEEGGRHTPFFEGYRPQFYVRTTDVTGKIESFRSDNDNPAQMVMPGDRIKMKVELIQPIAIEKGMRFAIREGGRTVGAGVVLSIIQ 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CHLVU (Elongation factor Tu, chloroplastic OS=Chlorella vulgaris GN=tufA PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.645e-63
Identity = 115/157 (73.25%), Postives = 139/157 (88.54%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            TV+LVGL++T+  TVTG+EMFQKTLDE++AGDNVG+LLRGVQK DI+RGMVLAKPG+I PHTKF A VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D +  ++MVMPGDRIKM+VELI P+A E+GMRFAIREGG+TVGAGV+ +I+
Sbjct:  252 TVELVGLRDTKTTTVTGLEMFQKTLDESVAGDNVGILLRGVQKIDIERGMVLAKPGSILPHTKFEAQVYVLNKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFRADDNTATQMVMPGDRIKMIVELIQPIAIEKGMRFAIREGGRTVGAGVVSTIV 408          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNJA (Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 4.787e-63
Identity = 114/158 (72.15%), Postives = 139/158 (87.97%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+LVGL+ETR+ TVTG+EMFQKTLDE +AGDNVG+LLRG+QK +++RGMVLAKP TITPHT+F + VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG ++S   D   + +MVMPGDR++M VELI P+A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  252 TVELVGLRETRSTTVTGLEMFQKTLDEGIAGDNVGVLLRGIQKNEVERGMVLAKPKTITPHTQFESEVYVLKKEEGGRHTPFFAGYRPQFYVRTTDVTGTITSFTADDGSKPEMVMPGDRVRMTVELIQPIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_OLTVI (Elongation factor Tu, chloroplastic OS=Oltmannsiellopsis viridis GN=tufA PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 4.787e-63
Identity = 116/157 (73.89%), Postives = 138/157 (87.90%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            TV+LVGLK+T   TVTG+EMFQKTLDE++AGDNVG+LLRGVQK +IQRGMVLAKPG+I+PHTKF A VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG++ S + D    S+MVMPGDR+KM+VELI P+A E+GMRFAIREGG+TVGAGV+  I+
Sbjct:  253 TVELVGLKDTTETTVTGLEMFQKTLDESVAGDNVGILLRGVQKENIQRGMVLAKPGSISPHTKFEAQVYVLTKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFVADDGSASQMVMPGDRVKMLVELINPIAVEKGMRFAIREGGRTVGAGVVSEIL 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNPW (Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 6.251e-63
Identity = 115/157 (73.25%), Postives = 135/157 (85.99%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VG+K+TR  TVTGVEMF+K LDE MAGDNVGLLLRG+QK DI+RGMVL KPG+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D   + +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 IEIVGIKDTRKTTVTGVEMFRKLLDEGMAGDNVGLLLRGIQKEDIERGMVLVKPGSITPHTKFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGSDVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_TRIEI (Elongation factor Tu OS=Trichodesmium erythraeum (strain IMS101) GN=tuf PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 8.165e-63
Identity = 118/158 (74.68%), Postives = 134/158 (84.81%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+LVG+K+TRN TVTGVEMFQK LDE MAGDNVGLLLRG+QK DIQRGMVLAK G+ITPH KF + VYVLKKEEGGRH+PFF  YRPQFY+RTTDVTG + S   D    ++MVMPGDRIKM V+LI PVA EQGMRFAIREGG+T+GAGV+  I+E
Sbjct:  252 TVELVGIKDTRNSTVTGVEMFQKILDEGMAGDNVGLLLRGMQKDDIQRGMVLAKSGSITPHKKFESEVYVLKKEEGGRHTPFFPNYRPQFYIRTTDVTGAIESFTADDGSVAEMVMPGDRIKMTVQLINPVAIEQGMRFAIREGGRTIGAGVVSKIVE 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_NEPOL (Elongation factor Tu, chloroplastic OS=Nephroselmis olivacea GN=tufA PE=3 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.066e-62
Identity = 115/157 (73.25%), Postives = 136/157 (86.62%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            T+++VGLK TR  TVTG+EMFQKTLD+++AGDNVG+LLRG+QK DIQRGMVLA P TITPHTKF + VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D   E+ MVMPGDR+KMVVELI P+A E+GMRFAIREGG+TVGAGV+ +II
Sbjct:  253 TIEIVGLKPTRETTVTGLEMFQKTLDQSVAGDNVGILLRGIQKEDIQRGMVLAAPRTITPHTKFESQVYVLTKEEGGRHTPFFPGYRPQFYVRTTDVTGKIDSFRADDGGEATMVMPGDRVKMVVELIQPIAIEKGMRFAIREGGRTVGAGVVSNII 409          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_SYNE75.654e-6472.78Elongation factor Tu OS=Synechococcus elongatus (s... [more]
EFTU_SYNJB9.645e-6473.42Elongation factor Tu OS=Synechococcus sp. GN=tuf P... [more]
EFTU_OSTTA9.645e-6471.52Elongation factor Tu, chloroplastic OS=Ostreococcu... [more]
EFTU_EUGGR9.645e-6472.78Elongation factor Tu, chloroplastic OS=Euglena gra... [more]
EFTU_CHLVU1.645e-6373.25Elongation factor Tu, chloroplastic OS=Chlorella v... [more]
EFTU_SYNJA4.787e-6372.15Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_OLTVI4.787e-6373.89Elongation factor Tu, chloroplastic OS=Oltmannsiel... [more]
EFTU_SYNPW6.251e-6373.25Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_TRIEI8.165e-6374.68Elongation factor Tu OS=Trichodesmium erythraeum (... [more]
EFTU_NEPOL1.066e-6273.25Elongation factor Tu, chloroplastic OS=Nephroselmi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top