DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CYAME (Elongation factor Tu, chloroplastic OS=Cyanidioschyzon merolae GN=tufA PE=3 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.066e-62
Identity = 116/158 (73.42%), Postives = 134/158 (84.81%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VGLK T+  TVTG+EMFQKTLDE +AGDNVG+LLRGVQK DI+RGMVLAKPG+ITPHTKF A VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG +     D   +++MVMPGDRIKM V LI PVA EQGMRFAIREGG+TVGAGV+  I+E
Sbjct:  253 TIEIVGLKNTKTTTVTGLEMFQKTLDEGIAGDNVGVLLRGVQKTDIERGMVLAKPGSITPHTKFEAEVYVLTKEEGGRHTPFFPGYRPQFYVRTTDVTGTIEDFTADDGSKAEMVMPGDRIKMCVNLIYPVAIEQGMRFAIREGGRTVGAGVVTKILE 410          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_GUITH (Elongation factor Tu, chloroplastic OS=Guillardia theta GN=tufA PE=3 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.819e-62
Identity = 111/158 (70.25%), Postives = 137/158 (86.71%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VGL+ETRN T+TG+EMFQK+LDEA+AGDNVG+L+RG+QK DI+RGMVLA PG+ITPHTKF   VYVL KEEGGRH+PFF+GYRPQFY+RTTDVTG ++   +D    ++MVMPGDRIKM  +LI P+A E+GMRFAIREGG+TVGAGV+  IIE
Sbjct:  251 TIEIVGLRETRNTTITGLEMFQKSLDEALAGDNVGILVRGIQKTDIERGMVLAAPGSITPHTKFEGEVYVLTKEEGGRHTPFFSGYRPQFYVRTTDVTGTIAQFTSDDGSTAEMVMPGDRIKMTAQLIHPIAIEKGMRFAIREGGRTVGAGVVSKIIE 408          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CYACA (Elongation factor Tu, chloroplastic OS=Cyanidium caldarium GN=tufA PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.376e-62
Identity = 115/158 (72.78%), Postives = 134/158 (84.81%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV++VGLK T + TVTG+EMFQKTLDE +AGDNVG+LLRGVQK DI+RGMVLAKPG+ITPH KF A VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG +S    D    ++MV+PGDRIKM VELI PVA EQGMRFAIREGG+TVGAG++  I++
Sbjct:  253 TVEIVGLKSTASTTVTGLEMFQKTLDEGLAGDNVGVLLRGVQKQDIERGMVLAKPGSITPHDKFEAEVYVLNKEEGGRHTPFFPGYRPQFYVRTTDVTGNISQFTTDDGGSAEMVLPGDRIKMTVELIHPVAIEQGMRFAIREGGRTVGAGIVSKILD 410          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_GRATL (Elongation factor Tu, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=tufA PE=3 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 3.103e-62
Identity = 112/158 (70.89%), Postives = 135/158 (85.44%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VGL+ET   T+TG+EMFQKTLDE MAGDN+G+LLRGVQK DI+RGMVLA+PGTITPHT+F A VY+L KEEGGRH+PFF+GYRPQFY+RTTDVTG ++    D    ++MVMPGDRIKM  ELI P+A EQGMRFAIREGG+TVGAGV+  I+E
Sbjct:  252 TIEIVGLRETTTTTITGLEMFQKTLDEGMAGDNIGILLRGVQKKDIERGMVLAQPGTITPHTQFEAEVYILTKEEGGRHTPFFSGYRPQFYVRTTDVTGTITQFTADDGSAAEMVMPGDRIKMSAELINPIAIEQGMRFAIREGGRTVGAGVVSKILE 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNY3 (Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803) GN=tuf PE=1 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 4.052e-62
Identity = 114/157 (72.61%), Postives = 133/157 (84.71%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            + +VG+K+TR  TVTGVEMFQKTL+E MAGDNVGLLLRG+QK DI+RGMVLAKPG+ITPHT+F   VYVLKKEEGGRH+PFFA YRPQFY+RTTDVTG + S   D     +MVMPGDRIKM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  243 ISIVGIKDTRKATVTGVEMFQKTLEEGMAGDNVGLLLRGIQKEDIERGMVLAKPGSITPHTEFEGEVYVLKKEEGGRHTPFFANYRPQFYVRTTDVTGTIKSYTADDGSAVEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILK 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNP2 (Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=tuf PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 4.052e-62
Identity = 113/158 (71.52%), Postives = 135/158 (85.44%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VG+++TR+ TVTGVEMFQKTLDE MAGDNVG+LLRGVQK DI+RGMVLAKPG+ITPHT F A VYVL KEEGGRH+PFF  YRPQFY+RTTDVTG +S+   D    ++MVMPGDRIKM VELI P+A EQGMRFAIREGG+T+GAG +  I++
Sbjct:  252 TIEIVGIRDTRSTTVTGVEMFQKTLDEGMAGDNVGVLLRGVQKDDIERGMVLAKPGSITPHTNFEAEVYVLTKEEGGRHTPFFPNYRPQFYVRTTDVTGTISAFTADDGSSAEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGTVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CYAPA (Elongation factor Tu, cyanelle OS=Cyanophora paradoxa GN=tufA PE=3 SV=2)

HSP 1 Score: 237.269 bits (604), Expect = 9.027e-62
Identity = 110/158 (69.62%), Postives = 137/158 (86.71%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+LVGLK+T++ TVTG+EMFQKTL+E MAGDN+G+LLRGVQK DI+RGMVLAKPG+ITPHT+F + VYVL K+EGGRH+PFF+GYRPQFY+RTTDVTG + +   D    ++MVMPGDRIKM V L+ P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  252 TVELVGLKDTKSTTVTGLEMFQKTLEEGMAGDNIGILLRGVQKTDIERGMVLAKPGSITPHTQFESEVYVLTKDEGGRHTPFFSGYRPQFYVRTTDVTGSIDAFTADDGSNAEMVMPGDRIKMTVSLVHPIAIEQGMRFAIREGGRTIGAGVVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROMT (Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.540e-61
Identity = 114/157 (72.61%), Postives = 134/157 (85.35%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++TR  TVTGVEMF+K LDE MAGDNVGLLLRG+QK DI+RGMVL K G+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 VEIVGIRDTRLTTVTGVEMFRKLLDEGMAGDNVGLLLRGIQKEDIERGMVLVKKGSITPHTKFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELIAPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROM5 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.540e-61
Identity = 115/157 (73.25%), Postives = 134/157 (85.35%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++TR  TVTGVEMF+K LDE MAGDNVGLLLRGVQK DI+RGMVL K G+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 VEIVGIRDTRLTTVTGVEMFRKLLDEGMAGDNVGLLLRGVQKEDIERGMVLVKKGSITPHTKFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGANVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROM1 (Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.540e-61
Identity = 114/157 (72.61%), Postives = 134/157 (85.35%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++TR  TVTGVEMF+K LDE MAGDNVGLLLRG+QK DI+RGMVL K G+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 VEIVGIRDTRLTTVTGVEMFRKLLDEGMAGDNVGLLLRGIQKEDIERGMVLVKKGSITPHTKFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELIAPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_CYAME1.066e-6273.42Elongation factor Tu, chloroplastic OS=Cyanidiosch... [more]
EFTU_GUITH1.819e-6270.25Elongation factor Tu, chloroplastic OS=Guillardia ... [more]
EFTU_CYACA2.376e-6272.78Elongation factor Tu, chloroplastic OS=Cyanidium c... [more]
EFTU_GRATL3.103e-6270.89Elongation factor Tu, chloroplastic OS=Gracilaria ... [more]
EFTU_SYNY34.052e-6272.61Elongation factor Tu OS=Synechocystis sp. (strain ... [more]
EFTU_SYNP24.052e-6271.52Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_CYAPA9.027e-6269.62Elongation factor Tu, cyanelle OS=Cyanophora parad... [more]
EFTU_PROMT1.540e-6172.61Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_PROM51.540e-6173.25Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_PROM11.540e-6172.61Elongation factor Tu OS=Prochlorococcus marinus (s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top