DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PORYE (Elongation factor Tu, chloroplastic OS=Porphyra yezoensis GN=tufA PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 2.011e-61
Identity = 110/158 (69.62%), Postives = 135/158 (85.44%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VGL+ETR  T+TG+EMFQKTL+E +AGDN+G+LLRGVQK DI+RGMVLAKPGTITPHT+F A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG ++    D   +++MVMPGDRIKM  ELI  +A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  252 TIEIVGLRETRTTTITGLEMFQKTLEEGLAGDNIGILLRGVQKKDIERGMVLAKPGTITPHTQFEAEVYILTKEEGGRHTPFFPGYRPQFYVRTTDVTGTINQFTADDGTDAEMVMPGDRIKMTAELINAIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PORPU (Elongation factor Tu, chloroplastic OS=Porphyra purpurea GN=tufA PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 2.011e-61
Identity = 110/158 (69.62%), Postives = 135/158 (85.44%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VGL+ETR  T+TG+EMFQKTL+E +AGDN+G+LLRGVQK DI+RGMVLAKPGTITPHT+F A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG ++    D   +++MVMPGDRIKM  ELI  +A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  252 TIEIVGLRETRTTTITGLEMFQKTLEEGLAGDNIGILLRGVQKKDIERGMVLAKPGTITPHTQFEAEVYILTKEEGGRHTPFFPGYRPQFYVRTTDVTGTINQFTADDGTDAEMVMPGDRIKMTAELINAIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNSC (Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 3.430e-61
Identity = 112/157 (71.34%), Postives = 133/157 (84.71%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VG+K+TR  TVTGVEMF+K LDE MAGDNVGLLLRG+QK DI+RGMVL KPG+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   +     +MVMPGD I+M  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 IEIVGIKDTRKTTVTGVEMFRKLLDEGMAGDNVGLLLRGIQKEDIERGMVLVKPGSITPHTKFEGQVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTAEDGSNVEMVMPGDNIQMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNR3 (Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 3.430e-61
Identity = 113/157 (71.97%), Postives = 133/157 (84.71%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VG+K+TR  TVTGVEMF+K LDE MAGDNVGLLLRG+QK DI+RGMVL KPG+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +      +MVMPGD IKM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 IEIVGIKDTRKSTVTGVEMFRKLLDEGMAGDNVGLLLRGIQKEDIERGMVLVKPGSITPHTKFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTDRDGGNVEMVMPGDNIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVTKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROMP (Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 3.430e-61
Identity = 115/157 (73.25%), Postives = 133/157 (84.71%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++TR  TVTGVEMF+K LDE MAGDNVGLLLRGVQK DI+RGMVL K G+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 VEIVGIRDTRLTTVTGVEMFRKLLDEGMAGDNVGLLLRGVQKEDIERGMVLVKKGSITPHTKFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGANVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROM4 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 3.430e-61
Identity = 115/157 (73.25%), Postives = 133/157 (84.71%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K+TR  TVTGVEMF+K LDE MAGDNVGLLLRGVQK DI+RGMVL K G+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  243 VEIVGIKDTRVTTVTGVEMFRKLLDEGMAGDNVGLLLRGVQKEDIERGMVLVKKGSITPHTKFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIK 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_EMIHU (Elongation factor Tu, chloroplastic OS=Emiliania huxleyi GN=tufA PE=3 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 4.480e-61
Identity = 111/158 (70.25%), Postives = 132/158 (83.54%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VGLK+T+  TVTG+EMFQKTLDE MAGDNVG+L+RGVQK DI+RGMVLA+PGTI+PH KF A VYVL K+EGGRH+PFF GYRPQFY+RT DVTG +     D    ++MVMPGDRIKM  ELI P+A EQGMRFAIREGG+TVGAGV+  I+E
Sbjct:  250 TIEIVGLKDTQTTTVTGIEMFQKTLDEGMAGDNVGILIRGVQKTDIERGMVLAQPGTISPHKKFEAEVYVLGKDEGGRHTPFFTGYRPQFYVRTIDVTGTIVQFTGDDGSAAEMVMPGDRIKMTAELINPIAIEQGMRFAIREGGRTVGAGVVSKILE 407          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SPIPL (Elongation factor Tu OS=Spirulina platensis GN=tuf PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 5.851e-61
Identity = 111/157 (70.70%), Postives = 131/157 (83.44%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            TV+L+G+K+TR  TVTG EMFQKTL+E MAGDNVGLLLRG+QK D+QRGMV+AKP +ITPHTKF A VY+LKKEEGGRH+PFF GYRPQFY+RTTDVTG +     D     +MV+PGDRI M V+LI P+A EQGMRFAIREGG+TVGAGV+  I+
Sbjct:  253 TVELIGIKDTRTTTVTGAEMFQKTLEEGMAGDNVGLLLRGIQKNDVQRGMVIAKPKSITPHTKFEAEVYILKKEEGGRHTPFFKGYRPQFYVRTTDVTGTIDEFTADDGSTPEMVIPGDRINMTVQLICPIAIEQGMRFAIREGGRTVGAGVVAKIL 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_GLOVI (Elongation factor Tu OS=Gloeobacter violaceus GN=tufA PE=3 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 5.851e-61
Identity = 107/158 (67.72%), Postives = 138/158 (87.34%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T++LVG++ TR+ TVTG+EMFQK+LDE +AGDN+G+LLRG++K D++RGMVLAKPG+ITPHT+F   VY+L KEEGGRH+PFFAGYRPQFY+RTTDVTG + +  +D+ + ++MVMPGDRIKM VELI P+A E GMRFAIREGG+TVGAGV+  I++
Sbjct:  252 TIELVGIRGTRSTTVTGLEMFQKSLDEGLAGDNIGVLLRGIKKEDVERGMVLAKPGSITPHTQFEGEVYILSKEEGGRHTPFFAGYRPQFYVRTTDVTGTIVTFTDDEGKSAEMVMPGDRIKMTVELINPIAIEDGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_THEEB (Elongation factor Tu OS=Thermosynechococcus elongatus (strain BP-1) GN=tuf PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 7.642e-61
Identity = 110/158 (69.62%), Postives = 136/158 (86.08%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+LVGL+ETR  TVTG+EMF+K+L+E +AGDN GLLLRG++K D++RGMV+AKPG+ITPHTKF   VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG ++S  +D    ++MVMPGDRIKM VELI P+A EQGMRFAIREGG+T+GAGV+  IIE
Sbjct:  252 TVELVGLRETRTTTVTGIEMFKKSLEEGIAGDNAGLLLRGLKKEDVERGMVIAKPGSITPHTKFEGEVYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTITSFTSDDGSAAEMVMPGDRIKMTVELIQPIAIEQGMRFAIREGGRTIGAGVVSKIIE 409          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_PORYE2.011e-6169.62Elongation factor Tu, chloroplastic OS=Porphyra ye... [more]
EFTU_PORPU2.011e-6169.62Elongation factor Tu, chloroplastic OS=Porphyra pu... [more]
EFTU_SYNSC3.430e-6171.34Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_SYNR33.430e-6171.97Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_PROMP3.430e-6173.25Elongation factor Tu OS=Prochlorococcus marinus su... [more]
EFTU_PROM43.430e-6173.25Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_EMIHU4.480e-6170.25Elongation factor Tu, chloroplastic OS=Emiliania h... [more]
EFTU_SPIPL5.851e-6170.70Elongation factor Tu OS=Spirulina platensis GN=tuf... [more]
EFTU_GLOVI5.851e-6167.72Elongation factor Tu OS=Gloeobacter violaceus GN=t... [more]
EFTU_THEEB7.642e-6169.62Elongation factor Tu OS=Thermosynechococcus elonga... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top