DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CYAA5 (Elongation factor Tu OS=Cyanothece sp. (strain ATCC 51142) GN=tuf PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 7.642e-61
Identity = 110/158 (69.62%), Postives = 133/158 (84.18%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VG+++TR+ TVTGVEMFQKTLDE MAGDNVGLLLRG++K DI+RGMV+AKPG+ITPHT+F   VYVL KEEGGRH+PFF  YRPQFY+RTTDVTG +     D     +MVMPGDRIKM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  252 TIEIVGIRDTRSTTVTGVEMFQKTLDEGMAGDNVGLLLRGIKKEDIERGMVIAKPGSITPHTQFEGEVYVLTKEEGGRHTPFFKNYRPQFYVRTTDVTGTIQDYTADDGSAVEMVMPGDRIKMTVELISPIAIEQGMRFAIREGGRTIGAGVVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_ANASP (Elongation factor Tu OS=Anabaena sp. (strain PCC 7120) GN=tuf PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 7.642e-61
Identity = 109/157 (69.43%), Postives = 137/157 (87.26%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V+LVG+++TRN TVTG+EMF+K+LDE MAGDN G+LLRG+QKADI+RGMVLAKPG+ITPHT+F   VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG + +  +D+ E  +MVMPGDRIK+ VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  253 VELVGIRDTRNTTVTGIEMFKKSLDEGMAGDNAGVLLRGIQKADIERGMVLAKPGSITPHTQFEGEVYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKAFTSDEGETVEMVMPGDRIKVTVELINPIAIEQGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROM2 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 9.981e-61
Identity = 113/157 (71.97%), Postives = 134/157 (85.35%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++TR  TVTGVEMF+K LDE MAGDNVGLLLRGVQK DI+RGMVL K G+ITPHT+F   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  243 VEIVGIRDTRLTTVTGVEMFRKLLDEGMAGDNVGLLLRGVQKEDIERGMVLVKKGSITPHTQFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIK 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_RHDSA (Elongation factor Tu, chloroplastic OS=Rhodomonas salina GN=tufA PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.702e-60
Identity = 107/158 (67.72%), Postives = 134/158 (84.81%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T++++GL+ETR  T+TG+EMFQK+L+EA+AGDNVG+L+RG+QK DI+RGMVLA PG+ITPHTKF   VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG ++    D    ++MVMPGDRIKM  +LI P+A E+GMRFAIREGG+TVGAGV+  I+E
Sbjct:  252 TIEIIGLRETRTTTITGLEMFQKSLEEALAGDNVGILVRGIQKTDIERGMVLAAPGSITPHTKFEGEVYVLTKEEGGRHTPFFTGYRPQFYVRTTDVTGTIAQFTADDGSAAEMVMPGDRIKMTAQLIHPIAIEKGMRFAIREGGRTVGAGVVSKILE 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROMS (Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.702e-60
Identity = 112/157 (71.34%), Postives = 134/157 (85.35%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++TR  TVTGVEMF+K LDE MAGDNVGLLLRGVQK DI+RGMVL K G+ITPHT+F   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  243 VEIVGIRDTRVTTVTGVEMFRKLLDEGMAGDNVGLLLRGVQKEDIERGMVLVKKGSITPHTQFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKILK 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROM9 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.702e-60
Identity = 112/157 (71.34%), Postives = 134/157 (85.35%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++TR  TVTGVEMF+K LDE MAGDNVGLLLRGVQK DI+RGMVL K G+ITPHT+F   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  243 VEIVGIRDTRLTTVTGVEMFRKLLDEGMAGDNVGLLLRGVQKEDIERGMVLVKKGSITPHTQFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKILK 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROM0 (Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.702e-60
Identity = 112/157 (71.34%), Postives = 134/157 (85.35%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++TR  TVTGVEMF+K LDE MAGDNVGLLLRGVQK DI+RGMVL K G+ITPHT+F   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++  +D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  243 VEIVGIRDTRLTTVTGVEMFRKLLDEGMAGDNVGLLLRGVQKEDIERGMVLVKKGSITPHTQFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGSNVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKILK 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNPX (Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 2.223e-60
Identity = 111/157 (70.70%), Postives = 131/157 (83.44%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VG+K+ R  TVTGVEMF+K L+E MAGDN GLLLRG+QK DI+RGMVL KPG+ITPHTKF   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D     +MVMPGDRIKM  ELI PVA E GMRFAIREGG+T+GAGV+  IIE
Sbjct:  243 IEIVGIKDARKTTVTGVEMFRKLLEEGMAGDNCGLLLRGIQKEDIERGMVLVKPGSITPHTKFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGSAVEMVMPGDRIKMTGELICPVAMENGMRFAIREGGRTIGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_ANAVT (Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 2.223e-60
Identity = 108/157 (68.79%), Postives = 136/157 (86.62%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V+LVG+++TRN TVTG+EMF+K+LDE MAGDN G+LLRG+QK DI+RGMVLAKPG+ITPHT+F   VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG + +  +D+ E  +MVMPGDRIK+ VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  253 VELVGIRDTRNTTVTGIEMFKKSLDEGMAGDNAGVLLRGIQKTDIERGMVLAKPGSITPHTQFEGEVYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKAFTSDEGEAVEMVMPGDRIKVTVELINPIAIEQGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROMA (Elongation factor Tu OS=Prochlorococcus marinus GN=tuf PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.904e-60
Identity = 112/157 (71.34%), Postives = 133/157 (84.71%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+++TR  TVTGVEMF+K LDE MAGDNVGLLLRG+QK DI+RGMVL K G+ITPHT+F   VYVLKKEEGGRH+PFFAGYRPQFY+RTTDVTG++++   D     +MVMPGDRIKM  ELI PVA EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  243 VEIVGIRDTRLTTVTGVEMFRKLLDEGMAGDNVGLLLRGIQKEDIERGMVLVKKGSITPHTQFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTADDGSSVEMVMPGDRIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIK 399          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_CYAA57.642e-6169.62Elongation factor Tu OS=Cyanothece sp. (strain ATC... [more]
EFTU_ANASP7.642e-6169.43Elongation factor Tu OS=Anabaena sp. (strain PCC 7... [more]
EFTU_PROM29.981e-6171.97Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_RHDSA1.702e-6067.72Elongation factor Tu, chloroplastic OS=Rhodomonas ... [more]
EFTU_PROMS1.702e-6071.34Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_PROM91.702e-6071.34Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_PROM01.702e-6071.34Elongation factor Tu OS=Prochlorococcus marinus (s... [more]
EFTU_SYNPX2.223e-6070.70Elongation factor Tu OS=Synechococcus sp. (strain ... [more]
EFTU_ANAVT2.223e-6068.79Elongation factor Tu OS=Anabaena variabilis (strai... [more]
EFTU_PROMA2.904e-6071.34Elongation factor Tu OS=Prochlorococcus marinus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top