DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CHLAT (Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 7.153e-59
Identity = 109/158 (68.99%), Postives = 134/158 (84.81%), Query Frame = 3
Query:    6 VDLVGLKETR-NFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VGL+E      VTG+EMFQKTL+E++AGDNVG+LLRG+QK DI+RGMVLAKPGTI PH  F A VY+L KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D   E++MVMPGDRIKMVV+LI P+A E+GMRFAIREGG+TVGAGV+ +I+E
Sbjct:  253 IEIVGLREAPVTSIVTGLEMFQKTLEESVAGDNVGILLRGIQKKDIERGMVLAKPGTIKPHKSFEAQVYILNKEEGGRHTPFFQGYRPQFYVRTTDVTGKIESFQADDGSETQMVMPGDRIKMVVQLIQPIAIEKGMRFAIREGGRTVGAGVVFNILE 410          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROWI (Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.220e-58
Identity = 110/158 (69.62%), Postives = 132/158 (83.54%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +V++VGL  T+  TVTG+EMFQKTLDE++AGDNVG+LLRG+QK +IQRGMVLAKP +ITPHT F A VYVL KEEGGR +PFF+GYRPQFY+RTTDVTG++ S   D  E  KMV+PGDRIKM  ELI P+A E+ MRFAIREGGKTVGAGV+  I++
Sbjct:  252 SVEIVGLGATKITTVTGLEMFQKTLDESIAGDNVGILLRGIQKTEIQRGMVLAKPKSITPHTNFEAQVYVLNKEEGGRDTPFFSGYRPQFYVRTTDVTGKIESFCTDAGEPIKMVLPGDRIKMKAELIQPIAIERNMRFAIREGGKTVGAGVVGKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CYAP7 (Elongation factor Tu OS=Cyanothece sp. (strain PCC 7424) GN=tuf PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.593e-58
Identity = 111/159 (69.81%), Postives = 132/159 (83.02%), Query Frame = 3
Query:    3 TVDLVGLKE-TRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV++VG+KE T++ TVTGVEMFQKTL+E +AGDNVGLLLRGVQK +I+RGMV+AKPG+I PHT+F   VYVL KEEGGRH+PFF  YRPQFY+RTTDVTG +     D     +MVMPGDRIKM VELI P+A EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  252 TVEIVGIKEKTKSTTVTGVEMFQKTLEEGLAGDNVGLLLRGVQKEEIERGMVIAKPGSIKPHTQFEGEVYVLTKEEGGRHTPFFKNYRPQFYVRTTDVTGTIVDYTADDGSAVEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKIIQ 410          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_NOSP7 (Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 4.636e-58
Identity = 105/158 (66.46%), Postives = 135/158 (85.44%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+L+GLK+TR   VTG+EMF+K+L+E +AGDN G+LLRG++K DI+RGMV+AKPG+ITPHT+F   VYVL ++EGGR +PFFAGYRPQFY+RTTDVTG + +  +D+ +E +MVMPGDRIKM VELI  +A EQGMRFAIREGG+T+GAGV+  II+
Sbjct:  252 TVELIGLKDTRTTAVTGIEMFKKSLEEGLAGDNAGVLLRGLKKEDIERGMVIAKPGSITPHTQFEGEVYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKAYTSDEGKEVEMVMPGDRIKMTVELINAIAIEQGMRFAIREGGRTIGAGVVSKIIK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_ODOSI (Elongation factor Tu, chloroplastic OS=Odontella sinensis GN=tufA PE=3 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.349e-57
Identity = 105/158 (66.46%), Postives = 129/158 (81.65%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV++VG+ +T+  T+TG+EMFQKTLDE  AGDNVG+LLRGV + DI+ GMVL++PGTITPHT F + VYVL K+EGGRH+PFF GYRPQFY+RTTDVTG ++    D     +MVMPGDRIKM  ELI PVA E+GMRFAIREGG+T+GAGV+  II+
Sbjct:  252 TVEIVGVGDTQTTTITGIEMFQKTLDEGFAGDNVGILLRGVTREDIEAGMVLSEPGTITPHTNFESEVYVLTKDEGGRHTPFFTGYRPQFYVRTTDVTGAITQFTADDGSIVEMVMPGDRIKMTAELIYPVAIEEGMRFAIREGGRTIGAGVVSKIIQ 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_MESVI (Elongation factor Tu, chloroplastic OS=Mesostigma viride GN=tufA PE=3 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.349e-57
Identity = 106/158 (67.09%), Postives = 132/158 (83.54%), Query Frame = 3
Query:    6 VDLVGLKET-RNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            VD+VGL    +N TVTG+EMFQKTL+E++AGDNVG+LLRG+QK  ++RGMVLAKP TI PH +F + VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG++ S   D   +++MVMPGDR+KMVV LI P+A E+GMRFAIREGG+TVGAG++  I+E
Sbjct:  253 VDIVGLANIPQNTTVTGLEMFQKTLEESVAGDNVGVLLRGIQKDQVERGMVLAKPNTIKPHIRFESEVYVLAKEEGGRHTPFFPGYRPQFYVRTTDVTGKIDSFKADDGSDTQMVMPGDRVKMVVSLIQPIAIEKGMRFAIREGGRTVGAGIVSEILE 410          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SCEOB (Elongation factor Tu, chloroplastic OS=Scenedesmus obliquus GN=tufA PE=3 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.762e-57
Identity = 108/166 (65.06%), Postives = 136/166 (81.93%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMN---------DKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V+L+GLK+T+   VTG+EMF+KTLDE MAGDNVG+LLRG+QK D++RGMVLAKPG+ITPHTKF A VYVL KEEGGRHSPF  GY+PQF++RTTDVTG++ S  +          ++  +KM MPGDRI++ V+LI PVA E+GMRFAIREGG+TVGAGV+ +I+E
Sbjct:  253 VELIGLKDTKATVVTGLEMFKKTLDETMAGDNVGVLLRGIQKKDVERGMVLAKPGSITPHTKFEAQVYVLTKEEGGRHSPFLVGYQPQFFIRTTDVTGKIVSFTHIQMKNPSSVAEEHSNKMAMPGDRIEVTVQLIYPVAVEKGMRFAIREGGRTVGAGVVTNILE 418          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_THAPS (Elongation factor Tu, chloroplastic OS=Thalassiosira pseudonana GN=tufA PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 5.126e-57
Identity = 104/157 (66.24%), Postives = 128/157 (81.53%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+ +T+  T+TG+EMFQKTL+E  AGDNVG+LLRGV + +I+RGMVL+KPGTITPHT F + VYVL KEEGGRH+PFF GYRPQFY+RTTDVTG +     D     +MVMPGDRIKM  ELI PVA E+GMRFAIREGG+T+GAGV+  I++
Sbjct:  253 VEIVGVGDTQTTTITGIEMFQKTLEEGFAGDNVGILLRGVTRENIERGMVLSKPGTITPHTNFESEVYVLTKEEGGRHTPFFTGYRPQFYVRTTDVTGSIEQFTADDGTIVEMVMPGDRIKMTAELIYPVAIEEGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PHATR (Elongation factor Tu, chloroplastic OS=Phaeodactylum tricornutum GN=tufA PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.142e-56
Identity = 103/157 (65.61%), Postives = 127/157 (80.89%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+ +T+  T+TG+EMFQKTL+E  AGDNVG+LLRGV + +I+RGMVLAKPGTITPHT F + VYVL K+EGGRH+PFF GYRPQFY+RTTDVTG ++    D     +MVMPGDRIKM  E I PVA E GMRFAIREGG+T+GAGV+  I++
Sbjct:  253 VEIVGVTDTQTTTITGIEMFQKTLEEGFAGDNVGILLRGVTRENIERGMVLAKPGTITPHTSFESEVYVLTKDEGGRHTPFFTGYRPQFYVRTTDVTGSITQFTADDGSVVEMVMPGDRIKMTAEFIYPVAIEAGMRFAIREGGRTIGAGVVSKIVK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CHLRE (Elongation factor Tu, chloroplastic OS=Chlamydomonas reinhardtii GN=tufA PE=3 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 4.339e-56
Identity = 108/166 (65.06%), Postives = 132/166 (79.52%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMN---------DKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VGL+ T+   VTG+EMF+KTLDE +AGDNVG+LLRGVQK DI+RGMV+AKPGTITPHTKF A VYVL KEEGGRHS F  GY+PQFY+RTTDVTG+V    +          ++  +KM MPGDRI M VELI P+A E+GMRFAIREGG+TVGAGV+ +I++
Sbjct:  253 VEIVGLRPTQTAVVTGLEMFKKTLDETLAGDNVGVLLRGVQKKDIERGMVIAKPGTITPHTKFEAQVYVLTKEEGGRHSAFMIGYQPQFYVRTTDVTGKVVGFNHIQMRNPSSVAEEHSNKMAMPGDRISMTVELINPIAIEKGMRFAIREGGRTVGAGVVTNIVQ 418          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_CHLAT7.153e-5968.99Elongation factor Tu, chloroplastic OS=Chlorokybus... [more]
EFTU_PROWI1.220e-5869.62Elongation factor Tu, plastid OS=Prototheca wicker... [more]
EFTU_CYAP71.593e-5869.81Elongation factor Tu OS=Cyanothece sp. (strain PCC... [more]
EFTU_NOSP74.636e-5866.46Elongation factor Tu OS=Nostoc punctiforme (strain... [more]
EFTU_ODOSI1.349e-5766.46Elongation factor Tu, chloroplastic OS=Odontella s... [more]
EFTU_MESVI1.349e-5767.09Elongation factor Tu, chloroplastic OS=Mesostigma ... [more]
EFTU_SCEOB1.762e-5765.06Elongation factor Tu, chloroplastic OS=Scenedesmus... [more]
EFTU_THAPS5.126e-5766.24Elongation factor Tu, chloroplastic OS=Thalassiosi... [more]
EFTU_PHATR1.142e-5665.61Elongation factor Tu, chloroplastic OS=Phaeodactyl... [more]
EFTU_CHLRE4.339e-5665.06Elongation factor Tu, chloroplastic OS=Chlamydomon... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top