DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_NEIMF (Elongation factor Tu OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.813e-55
Identity = 104/156 (66.67%), Postives = 127/156 (81.41%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            +++VGLKET+  T TGVEMF+K LDE  AGDNVG+LLRG ++ D++RG VLAKPGTITPHTKF A VYVL KEEGGRH+PFFA YRPQFY RTTDVTG V+      +E  +MVMPG+ + + VELI P+A E+G+RFAIREGG+TVGAGV+ S+I
Sbjct:  243 IEIVGLKETQKTTCTGVEMFRKLLDEGQAGDNVGVLLRGTKREDVERGQVLAKPGTITPHTKFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGAVT-----LEEGVEMVMPGENVTITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVI 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_NEIMB (Elongation factor Tu OS=Neisseria meningitidis serogroup B GN=tufA PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.813e-55
Identity = 104/156 (66.67%), Postives = 127/156 (81.41%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            +++VGLKET+  T TGVEMF+K LDE  AGDNVG+LLRG ++ D++RG VLAKPGTITPHTKF A VYVL KEEGGRH+PFFA YRPQFY RTTDVTG V+      +E  +MVMPG+ + + VELI P+A E+G+RFAIREGG+TVGAGV+ S+I
Sbjct:  243 IEIVGLKETQKTTCTGVEMFRKLLDEGQAGDNVGVLLRGTKREDVERGQVLAKPGTITPHTKFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGAVT-----LEEGVEMVMPGENVTITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVI 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_NEIMA (Elongation factor Tu OS=Neisseria meningitidis serogroup A GN=tufA PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.813e-55
Identity = 104/156 (66.67%), Postives = 127/156 (81.41%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            +++VGLKET+  T TGVEMF+K LDE  AGDNVG+LLRG ++ D++RG VLAKPGTITPHTKF A VYVL KEEGGRH+PFFA YRPQFY RTTDVTG V+      +E  +MVMPG+ + + VELI P+A E+G+RFAIREGG+TVGAGV+ S+I
Sbjct:  243 IEIVGLKETQKTTCTGVEMFRKLLDEGQAGDNVGVLLRGTKREDVERGQVLAKPGTITPHTKFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGAVT-----LEEGVEMVMPGENVTITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVI 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_NEIG1 (Elongation factor Tu OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 8.184e-55
Identity = 103/156 (66.03%), Postives = 127/156 (81.41%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            +++VGLKET+  T TGVEMF+K LDE  AGDNVG+LLRG ++ D++RG VLAKPGTITPHTKF A VYVL KEEGGRH+PFFA YRPQFY RTTDVTG V+      ++  +MVMPG+ + + VELI P+A E+G+RFAIREGG+TVGAGV+ S+I
Sbjct:  243 IEIVGLKETQKTTCTGVEMFRKLLDEGQAGDNVGVLLRGTKREDVERGQVLAKPGTITPHTKFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGAVT-----LEKGVEMVMPGENVTITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVI 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CYCME (Elongation factor Tu, chloroplastic OS=Cyclotella meneghiniana GN=tufA PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.069e-54
Identity = 101/157 (64.33%), Postives = 124/157 (78.98%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+ +T+  T+TG+EMFQKTL+E  AGDNVG+LLRGV + +I+RGMVLAKPGTITPHT F + VYVL KEEGGRH+PFF GY P FY+ TTDVTG +     D     +MVMPGDRIKM  ELI PVA E+GMRF IREGG+T+GAGV+  I++
Sbjct:  253 VEIVGIGDTKTTTITGIEMFQKTLEEGFAGDNVGILLRGVTRENIERGMVLAKPGTITPHTNFESEVYVLTKEEGGRHTPFFTGYSPIFYVITTDVTGSIDQFTADDGSIVEMVMPGDRIKMTAELIYPVAIEEGMRFVIREGGRTIGAGVVSKIVK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CODFR (Elongation factor Tu, chloroplastic OS=Codium fragile GN=tufA PE=3 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.823e-54
Identity = 104/159 (65.41%), Postives = 129/159 (81.13%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDE-ESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+LVGLK T+   +TG+EMF KTL++++AGDNVG+LLR +QK +IQRGMVLAKP +I PH  F A VY+LKKEEGGRH+ FFAGYRPQFY+RTTDVTG + +     D  + +MVMPGDRI+M VELI P+A E  MRFAIREGGKTVGAGV+ +I++
Sbjct:  251 TVELVGLKNTKEAIITGLEMFHKTLEKSVAGDNVGILLRRIQKEEIQRGMVLAKPSSILPHQHFKAQVYILKKEEGGRHTSFFAGYRPQFYVRTTDVTGHIKTFQGKIDNTQIQMVMPGDRIQMEVELIRPIAIETRMRFAIREGGKTVGAGVVTTIVQ 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SORC5 (Elongation factor Tu OS=Sorangium cellulosum (strain So ce56) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 5.304e-54
Identity = 105/156 (67.31%), Postives = 122/156 (78.21%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            V ++G K+T+   VTGVEMF+K LD+  AGDNVG LLRGV+K +I+RG VLAKPG+ITPHTKF   VYVLKKEEGGRH+PFF  YRPQFY+RTTDVTG V     +  E  KMVMPGD I M +ELI PVA E+ MRFAIREGGKTVGAGV+  I+
Sbjct:  245 VQIIGFKDTKKSVVTGVEMFRKLLDQGQAGDNVGCLLRGVEKEEIERGQVLAKPGSITPHTKFTGEVYVLKKEEGGRHTPFFTNYRPQFYIRTTDVTGTV-----NLPEGVKMVMPGDNITMTIELIAPVALEEQMRFAIREGGKTVGAGVVTKIL 395          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PELPB (Elongation factor Tu OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=tuf PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 5.304e-54
Identity = 103/157 (65.61%), Postives = 125/157 (79.62%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VGL+ TR   VTG+EMFQK LDE  AGDN GLLLRGV K +++RGMV+AKPGTI PHTKF A VY+LKKEEGGRH+PFF GYRPQFY RTTDVTG V+       E  +MVMPGD + + VEL+ P+A ++G+RFAIREGG+TVGAG + +IIE
Sbjct:  242 VEIVGLRPTRKSVVTGIEMFQKLLDEGQAGDNAGLLLRGVDKTELERGMVIAKPGTIKPHTKFKAEVYILKKEEGGRHTPFFNGYRPQFYFRTTDVTGSVT-----LPEGVEMVMPGDNLGVEVELLAPIAMDEGLRFAIREGGRTVGAGSVTTIIE 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_ALKOO (Elongation factor Tu OS=Alkaliphilus oremlandii (strain OhILAs) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 5.304e-54
Identity = 106/158 (67.09%), Postives = 126/158 (79.75%), Query Frame = 3
Query:    6 VDLVGLKE-TRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V+LVGL+E +R   VTGVEMF+K LD+A AGDNVGLLLRG+Q+ +IQRG VL KPGTI PHTKF A VYVLKKEEGGRH+PFF GYRPQFY RTTDVTG          +  +MVMPGD + M ++LI P+A E+G+RFAIREGG+TVG+GV+ SIIE
Sbjct:  245 VELVGLQEDSRKIVVTGVEMFRKLLDQAQAGDNVGLLLRGIQRTEIQRGQVLCKPGTIKPHTKFKAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTDVTGATK-----LPDGMEMVMPGDNVTMEIDLIHPIAIEEGLRFAIREGGRTVGSGVVASIIE 397          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_HERAU (Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 6.928e-54
Identity = 103/158 (65.19%), Postives = 127/158 (80.38%), Query Frame = 3
Query:    3 TVDLVGL-KETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            T++++G+  + R   VTGVEMF+K LDE  AGDNVG LLRG+++ D++RG VLAKPG+I PHTKF A VYVLKKEEGGRHSPFF+GYRPQFY+RTTDVTG +        E  +MVMPGD I+M VELI+PVA EQG++FAIREGG+TVGAG++  II
Sbjct:  247 TIEIIGMGPDVRTTAVTGVEMFKKLLDEGRAGDNVGALLRGIERTDVERGQVLAKPGSIKPHTKFKAEVYVLKKEEGGRHSPFFSGYRPQFYVRTTDVTGAIG-----LPEGVEMVMPGDNIQMTVELIVPVAIEQGLKFAIREGGRTVGAGIVPEII 399          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_NEIMF2.813e-5566.67Elongation factor Tu OS=Neisseria meningitidis ser... [more]
EFTU_NEIMB2.813e-5566.67Elongation factor Tu OS=Neisseria meningitidis ser... [more]
EFTU_NEIMA2.813e-5566.67Elongation factor Tu OS=Neisseria meningitidis ser... [more]
EFTU_NEIG18.184e-5566.03Elongation factor Tu OS=Neisseria gonorrhoeae (str... [more]
EFTU_CYCME1.069e-5464.33Elongation factor Tu, chloroplastic OS=Cyclotella ... [more]
EFTU_CODFR1.823e-5465.41Elongation factor Tu, chloroplastic OS=Codium frag... [more]
EFTU_SORC55.304e-5467.31Elongation factor Tu OS=Sorangium cellulosum (stra... [more]
EFTU_PELPB5.304e-5465.61Elongation factor Tu OS=Pelodictyon phaeoclathrati... [more]
EFTU_ALKOO5.304e-5467.09Elongation factor Tu OS=Alkaliphilus oremlandii (s... [more]
EFTU_HERAU6.928e-5465.19Elongation factor Tu OS=Herpetosiphon aurantiacus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top