DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CHLL2 (Elongation factor Tu OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=tuf PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 6.928e-54
Identity = 102/157 (64.97%), Postives = 125/157 (79.62%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K TR   VTG+EMFQK LDE  AGDN GLLLRGV K +++RGMV+AKPG+I PHTKF A VY+L+KEEGGRH+PFF GYRPQFY RTTDVTG V+       E  +MVMPGD + + VELI+P+A ++G+RFAIREGG+TVGAG +  IIE
Sbjct:  242 VEIVGIKPTRKSVVTGIEMFQKLLDEGQAGDNAGLLLRGVDKTELERGMVIAKPGSIKPHTKFKAEVYILRKEEGGRHTPFFNGYRPQFYFRTTDVTGSVT-----LPEGVEMVMPGDNLSVEVELIVPIAMDEGLRFAIREGGRTVGAGSVTKIIE 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CHAVU (Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 6.928e-54
Identity = 96/158 (60.76%), Postives = 132/158 (83.54%), Query Frame = 3
Query:    6 VDLVGLKET-RNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V+L+GL E  R+  VTG+EMF++ L++  AG+N+G+LLRG++K DI+RGMV+A+PGTI PHT+F A VY+L+KEEGGRHSPFFAGYRPQF++RT DVTG + +   D  ++++MVMPGDR+KM+V LI P+A E+ MRFAIREGG+T+GAGV+  I++
Sbjct:  253 VELIGLNEKIRSTVVTGLEMFRRLLEQGFAGENIGVLLRGIEKKDIERGMVIAQPGTIEPHTRFEAQVYILRKEEGGRHSPFFAGYRPQFFVRTADVTGVIEAFEYDNGDKTRMVMPGDRVKMIVNLICPIAIEKKMRFAIREGGRTIGAGVVLQILD 410          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROA2 (Elongation factor Tu OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=tuf PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 9.048e-54
Identity = 101/157 (64.33%), Postives = 124/157 (78.98%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K TR   VTG+EMFQKTLD+  AGDN G+L RGV K +++RGMV+AKPGTITPHTKF A VY+LKKEEGGRH+PFF  YRPQFY RTTDVTG V+       E  +MVMPGD + + VELI+P+A ++ +RFAIREGG+TVGAG +  IIE
Sbjct:  242 VEIVGIKPTRKSVVTGIEMFQKTLDQGQAGDNAGILFRGVDKEELERGMVIAKPGTITPHTKFKAEVYILKKEEGGRHTPFFNNYRPQFYFRTTDVTGAVT-----LPEGVEMVMPGDNLSVEVELIVPIAMDENLRFAIREGGRTVGAGTVTQIIE 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PROVI (Elongation factor Tu OS=Prosthecochloris vibrioformis (strain DSM 265) (strain DSM 265) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 102/155 (65.81%), Postives = 122/155 (78.71%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSI 470
            V++VG+++TR   VTG+EMFQK LDE  AGDN GLLLRGV K D++RGMV+AKPGTI PHTKF A VY+LKKEEGGRH+PFF  YRPQFY RTTDVTG VS       E  +MVMPGD + + VELI P+A ++G+RFAIREGG+TVGAG +  I
Sbjct:  242 VEIVGIRDTRKSVVTGIEMFQKLLDEGQAGDNAGLLLRGVDKNDLERGMVIAKPGTIKPHTKFKAEVYILKKEEGGRHTPFFTNYRPQFYFRTTDVTGAVS-----LPEGVEMVMPGDNLSVEVELIAPIAMDEGLRFAIREGGRTVGAGSVTKI 391          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PELLD (Elongation factor Tu OS=Pelodictyon luteolum (strain DSM 273) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 102/157 (64.97%), Postives = 123/157 (78.34%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K+TR   VTG+EMFQK LDE  AGDN GLLLRGV K +++RGMV+AKPGTI PHTKF A VY+LKKEEGGRH+PFF  YRPQFY RTTDVTG V+       E  +MVMPGD + + VELI P+A ++G+RFAIREGG+TVGAG +  I E
Sbjct:  242 VEIVGIKDTRKSVVTGIEMFQKLLDEGQAGDNAGLLLRGVDKTELERGMVIAKPGTIKPHTKFKAEVYILKKEEGGRHTPFFTNYRPQFYFRTTDVTGAVT-----LPEGVEMVMPGDNLSVDVELIAPIAMDEGLRFAIREGGRTVGAGSVTKISE 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_NITSB (Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 101/157 (64.33%), Postives = 127/157 (80.89%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            +++VGL+ T+  TVTGVEMF+K LD+  AGDNVG+LLRG +K +++RG VLA+PGTITPHTKF A +YVL KEEGGRH+PFF+GYRPQFY+RTTDVTG ++       E  +MVMPGD +K+  ELI P+A E+G RFAIREGG+TVGAGV+  IIE
Sbjct:  248 IEIVGLRPTQKTTVTGVEMFRKELDQGEAGDNVGVLLRGTKKEEVERGQVLAQPGTITPHTKFEAEIYVLTKEEGGRHTPFFSGYRPQFYVRTTDVTGTIT-----LPEGVEMVMPGDNVKINAELIAPIALEEGTRFAIREGGRTVGAGVVSKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_NAUPA (Elongation factor Tu OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 104/157 (66.24%), Postives = 123/157 (78.34%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            VD+VG K T    VTG+EMF+K +DEA AGDNVG+LLRG++K +++RG VLAKPG+ITPHTKF A VY L KEEGGRH PFF GYRPQFY+RTTDVTG V        E  +MVMPGD +K+ VELI P+A E+G RFAIREGG+TVGAGV+  IIE
Sbjct:  248 VDIVGFKPTVTTKVTGIEMFRKEMDEAQAGDNVGVLLRGIKKDEVERGQVLAKPGSITPHTKFEAEVYALTKEEGGRHKPFFNGYRPQFYIRTTDVTGSVI-----LPEGVEMVMPGDNVKLTVELIAPIALEEGTRFAIREGGRTVGAGVVTKIIE 399          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_GEOSL (Elongation factor Tu OS=Geobacter sulfurreducens GN=tuf1 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 102/157 (64.97%), Postives = 124/157 (78.98%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K T   TVTGVEMF+K LDE  AGDN+G LLRGV++ DI+RG VLAKPG+ITPHTKF A  Y+L KEEGGRH+PFF GYRPQFY RTTDVTG V     D    ++MVMPGD + + + LI P+A ++G+RFAIREGG+TVGAGV+ SIIE
Sbjct:  245 VEIVGIKATAKTTVTGVEMFRKLLDEGRAGDNIGALLRGVKREDIERGQVLAKPGSITPHTKFKAEAYILTKEEGGRHTPFFNGYRPQFYFRTTDVTGVV-----DLPAGTEMVMPGDNVAVTINLITPIAMDEGLRFAIREGGRTVGAGVVSSIIE 396          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CHLPD (Elongation factor Tu OS=Chlorobium phaeobacteroides (strain DSM 266) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 102/157 (64.97%), Postives = 124/157 (78.98%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K TR   VTG+EMFQK LDE  AGDN GLLLRGV K +++RGMV+AKPGTI PHTKF A VY+L+KEEGGRH+PFF GYRPQFY RTTDVTG V+       E  +MVMPGD + + VELI+P+A ++ +RFAIREGG+TVGAG +  IIE
Sbjct:  242 VEIVGIKPTRKSVVTGIEMFQKLLDEGQAGDNAGLLLRGVDKTELERGMVIAKPGTIKPHTKFKAEVYILRKEEGGRHTPFFNGYRPQFYFRTTDVTGSVT-----LPEGVEMVMPGDNLSVDVELIVPIAMDENLRFAIREGGRTVGAGSVTKIIE 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CHLP8 (Elongation factor Tu OS=Chlorobaculum parvum (strain NCIB 8327) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 103/157 (65.61%), Postives = 123/157 (78.34%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K T    VTG+EMFQKTLDE  AGDN GLLLRGV K  ++RGMV+AKPG+ITPHTKF A VY+LKKEEGGRH+PFF GYRPQFY RTTDVTG V+       E  +MVMPGD + + VELI P+A E+ +RFAIREGG+TVGAG +  I+E
Sbjct:  242 VEIVGIKPTTKSVVTGIEMFQKTLDEGQAGDNAGLLLRGVDKEALERGMVIAKPGSITPHTKFKAEVYILKKEEGGRHTPFFNGYRPQFYFRTTDVTGSVT-----LPEGVEMVMPGDNLSVDVELIAPIAMEESLRFAIREGGRTVGAGSVTKIVE 393          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_CHLL26.928e-5464.97Elongation factor Tu OS=Chlorobium limicola (strai... [more]
EFTU_CHAVU6.928e-5460.76Elongation factor Tu, chloroplastic OS=Chara vulga... [more]
EFTU_PROA29.048e-5464.33Elongation factor Tu OS=Prosthecochloris aestuarii... [more]
EFTU_PROVI1.543e-5365.81Elongation factor Tu OS=Prosthecochloris vibriofor... [more]
EFTU_PELLD1.543e-5364.97Elongation factor Tu OS=Pelodictyon luteolum (stra... [more]
EFTU_NITSB1.543e-5364.33Elongation factor Tu OS=Nitratiruptor sp. (strain ... [more]
EFTU_NAUPA1.543e-5366.24Elongation factor Tu OS=Nautilia profundicola (str... [more]
EFTU_GEOSL1.543e-5364.97Elongation factor Tu OS=Geobacter sulfurreducens G... [more]
EFTU_CHLPD1.543e-5364.97Elongation factor Tu OS=Chlorobium phaeobacteroide... [more]
EFTU_CHLP81.543e-5365.61Elongation factor Tu OS=Chlorobaculum parvum (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top