DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CAMHC (Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 104/157 (66.24%), Postives = 124/157 (78.98%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            TV+LVG+K T+  TVTGVEMF+K LDE  AGDNVG+LLRG  K D++RGMVLAKP +ITPHTKF A VY+L KEEGGRH+PFF  YRPQFY+RTTDVTG +        E ++MVMPGD +K+ VELI P+A EQG RFAIREGG TVG+GV+  I+
Sbjct:  247 TVELVGIKPTQTTTVTGVEMFRKELDEGEAGDNVGVLLRGTAKEDVERGMVLAKPKSITPHTKFEAEVYILTKEEGGRHTPFFNNYRPQFYVRTTDVTGSI-----QLPEGTEMVMPGDNVKITVELIHPIALEQGTRFAIREGGHTVGSGVVSKIL 398          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_AERS4 (Elongation factor Tu OS=Aeromonas salmonicida (strain A449) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 102/157 (64.97%), Postives = 126/157 (80.25%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            TV++VG+K+T + T TGVEMF+K LDE  AG+N+G LLRGV++ D++RG VLAKPG+I PHTKF + VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD IKMVV LI P+A + G+RFAIREGG+TVGAGV+ S+I
Sbjct:  242 TVEIVGIKDTVSTTCTGVEMFRKLLDEGRAGENIGALLRGVKREDVERGQVLAKPGSIKPHTKFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNIKMVVTLIAPIAMDDGLRFAIREGGRTVGAGVVASVI 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU2_THETN (Elongation factor Tu-B OS=Thermoanaerobacter tengcongensis GN=tufB PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 104/158 (65.82%), Postives = 127/158 (80.38%), Query Frame = 3
Query:    6 VDLVGLK-ETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V+++GL  E+R   VTGVEMF+KTLDEA AGDN+G+LLRG+QK +++RG VLAKPGTI PHTKF A VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +        E  +MVMPGD + + VELI P+A E+G++FAIREGG+TVGAGV+ +IIE
Sbjct:  248 VEIIGLTTESRKTVVTGVEMFRKTLDEAQAGDNIGVLLRGIQKDEVERGQVLAKPGTIKPHTKFEAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGTI-----QLPEGVEMVMPGDHVTLRVELITPIAMEEGLKFAIREGGRTVGAGVVSAIIE 400          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU1_ROSS1 (Elongation factor Tu 1 OS=Roseiflexus sp. (strain RS-1) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.543e-53
Identity = 102/160 (63.75%), Postives = 130/160 (81.25%), Query Frame = 3
Query:    3 TVDLVGL--KETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+++G+  +  R   VTGVEMFQKTLDE +AGDNVG+LLRG+++ +++RG VLA PG+I PH KF A VYVLKKEEGGRH+PFF+GYRPQFY+RTTDVTG +        E  +MVMPGD I+M VELI+PVA E+G+RFAIREGG+TVGAGV+ +I++
Sbjct:  247 TVEIIGMTHEAPRRTVVTGVEMFQKTLDEGIAGDNVGVLLRGIERTEVERGQVLAAPGSIKPHAKFKANVYVLKKEEGGRHTPFFSGYRPQFYIRTTDVTGAI-----HLPEGVEMVMPGDNIEMTVELIVPVAIEEGLRFAIREGGRTVGAGVVSAIVD 401          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_MOOTA (Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.016e-53
Identity = 105/158 (66.46%), Postives = 127/158 (80.38%), Query Frame = 3
Query:    6 VDLVGLK-ETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V+++GL+ E R   VTGVEMF+K LDEA+AGDN+G LLRGV + +++RGMVLAKPG+I PHTKF A VYVL KEEGGRH+PFF GYRPQFY RTTDVTG V     +  E  +MVMPGD I+M +ELI P+A E+G+RFAIREGG+TVGAGV+  IIE
Sbjct:  248 VEIIGLRDEIRKTVVTGVEMFRKILDEAVAGDNIGTLLRGVDRKEVERGMVLAKPGSIKPHTKFNAEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVV-----NLPEGVEMVMPGDNIRMTIELITPIAIEEGLRFAIREGGRTVGAGVVTGIIE 400          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CHRVO (Elongation factor Tu OS=Chromobacterium violaceum GN=tuf1 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.016e-53
Identity = 102/156 (65.38%), Postives = 125/156 (80.13%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            +++VGLK+T   T TGVEMF+K LD+  AGDNVG+LLRG ++ D++RG VLAKPGTITPHTKF A VYVL K+EGGRH+PFFA YRPQFY RTTDVTG +S       E  +MVMPGD +++ VELI P+A E+G+RFAIREGG+TVGAGV+  II
Sbjct:  245 LEIVGLKDTVKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLAKPGTITPHTKFEASVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGAISLA-----EGVEMVMPGDNVEIKVELIAPIAMEEGLRFAIREGGRTVGAGVVAKII 395          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_CHLTE (Elongation factor Tu OS=Chlorobium tepidum GN=tuf PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.016e-53
Identity = 103/157 (65.61%), Postives = 123/157 (78.34%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K T    VTG+EMFQKTLDE  AGDN GLLLRGV K  ++RGMV+AKPG+ITPHTKF A VY+LKKEEGGRH+PFF GYRPQFY RTTDVTG V+       E  +MVMPGD + + VELI P+A E+ +RFAIREGG+TVGAG +  I+E
Sbjct:  242 VEIVGIKPTAKSVVTGIEMFQKTLDEGQAGDNAGLLLRGVDKNALERGMVIAKPGSITPHTKFKAEVYILKKEEGGRHTPFFNGYRPQFYFRTTDVTGSVT-----LPEGVEMVMPGDNLSIDVELIAPIAMEESLRFAIREGGRTVGAGSVTKIVE 393          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_ACTSZ (Elongation factor Tu OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.016e-53
Identity = 100/157 (63.69%), Postives = 126/157 (80.25%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K+T   TVTGVEMF+K LDE  AG+N+G LLRG ++ +I+RG VLAKPG+ITPHT F++ VYVL KEEGGRH+PFF GYRPQFY RTTDVTG +     +  E  +MVMPGD +KM V LI P+A +QG+RFAIREGG+TVGAGV+ S+I+
Sbjct:  243 VEIVGIKDTTKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSITPHTDFVSEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTI-----ELPEGVEMVMPGDNVKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVASVIK 394          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PSEAE (Elongation factor Tu OS=Pseudomonas aeruginosa GN=tufA PE=3 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 2.633e-53
Identity = 104/157 (66.24%), Postives = 121/157 (77.07%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K T   T TGVEMF+K LDE  AG+NVG+LLRG ++ D++RG VLAKPGTI PHTKF   VYVL KEEGGRH+PFF GYRPQFY RTTDVTG       +  E  +MVMPGD IKMVV LI P+A E G+RFAIREGG+TVGAGV+  IIE
Sbjct:  246 VEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPGTIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNC-----ELPEGVEMVMPGDNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE 397          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PSEAB (Elongation factor Tu OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tuf1 PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.633e-53
Identity = 104/157 (66.24%), Postives = 121/157 (77.07%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            V++VG+K T   T TGVEMF+K LDE  AG+NVG+LLRG ++ D++RG VLAKPGTI PHTKF   VYVL KEEGGRH+PFF GYRPQFY RTTDVTG       +  E  +MVMPGD IKMVV LI P+A E G+RFAIREGG+TVGAGV+  IIE
Sbjct:  246 VEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPGTIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNC-----ELPEGVEMVMPGDNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE 397          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU_CAMHC1.543e-5366.24Elongation factor Tu OS=Campylobacter hominis (str... [more]
EFTU_AERS41.543e-5364.97Elongation factor Tu OS=Aeromonas salmonicida (str... [more]
EFTU2_THETN1.543e-5365.82Elongation factor Tu-B OS=Thermoanaerobacter tengc... [more]
EFTU1_ROSS11.543e-5363.75Elongation factor Tu 1 OS=Roseiflexus sp. (strain ... [more]
EFTU_MOOTA2.016e-5366.46Elongation factor Tu OS=Moorella thermoacetica (st... [more]
EFTU_CHRVO2.016e-5365.38Elongation factor Tu OS=Chromobacterium violaceum ... [more]
EFTU_CHLTE2.016e-5365.61Elongation factor Tu OS=Chlorobium tepidum GN=tuf ... [more]
EFTU_ACTSZ2.016e-5363.69Elongation factor Tu OS=Actinobacillus succinogene... [more]
EFTU_PSEAE2.633e-5366.24Elongation factor Tu OS=Pseudomonas aeruginosa GN=... [more]
EFTU_PSEAB2.633e-5366.24Elongation factor Tu OS=Pseudomonas aeruginosa (st... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top