DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_PANTR (Peptidyl-prolyl cis-trans isomerase A OS=Pan troglodytes GN=PPIA PE=3 SV=3)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_PANPA (Peptidyl-prolyl cis-trans isomerase A OS=Pan paniscus GN=PPIA PE=3 SV=3)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_MACMU (Peptidyl-prolyl cis-trans isomerase A OS=Macaca mulatta GN=PPIA PE=1 SV=2)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_HYLSY (Peptidyl-prolyl cis-trans isomerase A OS=Hylobates syndactylus GN=PPIA PE=3 SV=3)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_HYLLE (Peptidyl-prolyl cis-trans isomerase A OS=Hylobates leucogenys GN=PPIA PE=3 SV=3)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_HYLLA (Peptidyl-prolyl cis-trans isomerase A OS=Hylobates lar GN=PPIA PE=3 SV=3)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_HUMAN (Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens GN=PPIA PE=1 SV=2)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_GORGO (Peptidyl-prolyl cis-trans isomerase A OS=Gorilla gorilla gorilla GN=PPIA PE=3 SV=3)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_CERAE (Peptidyl-prolyl cis-trans isomerase A OS=Cercopithecus aethiops GN=PPIA PE=2 SV=2)

HSP 1 Score: 237.269 bits (604), Expect = 7.639e-62
Identity = 113/171 (66.08%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD+ V G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGS FHR+IPGFMCQ            +SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:    1 MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_CRIGR (Peptidyl-prolyl cis-trans isomerase A OS=Cricetulus griseus GN=PPIA PE=2 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 1.303e-61
Identity = 112/171 (65.50%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NP VFFD++  G+P GR+  ELFAD  P+TAENFRAL TGEKG G       YKGSSFHR+IPGFMCQ             SIYG KF DENF+ KHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFG+V EGM++V+A+E+ GS +G+T+K + I+DCGQL
Sbjct:    1 MVNPTVFFDISADGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG-------YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL 164          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
PPIA_PANTR7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Pan trogl... [more]
PPIA_PANPA7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Pan panis... [more]
PPIA_MACMU7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Macaca mu... [more]
PPIA_HYLSY7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Hylobates... [more]
PPIA_HYLLE7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Hylobates... [more]
PPIA_HYLLA7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Hylobates... [more]
PPIA_HUMAN7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Homo sapi... [more]
PPIA_GORGO7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Gorilla g... [more]
PPIA_CERAE7.639e-6266.08Peptidyl-prolyl cis-trans isomerase A OS=Cercopith... [more]
PPIA_CRIGR1.303e-6165.50Peptidyl-prolyl cis-trans isomerase A OS=Cricetulu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top