DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_RHIOR (Peptidyl-prolyl cis-trans isomerase D OS=Rhizopus oryzae GN=cyp12 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.109e-55
Identity = 105/172 (61.05%), Postives = 126/172 (73.26%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            M NP+V+FD+T+G +P GRIV ELF D+ P+TAENFRALCTGEKG GKSGKPL Y+GS FHR+I  FM Q            ESIYG KF DENFV KH  P +LSMANAGPGTNGSQFF+ T  T  LDGKHVVFG+V++G  VV+A+E + + S R  +  VIA CG+L+
Sbjct:    1 MSNPRVYFDITIGNKPEGRIVFELFKDIVPKTAENFRALCTGEKGEGKSGKPLSYQGSLFHRIIKNFMIQGGDFTAGNGTGGESIYGEKFEDENFVLKHEKPFLLSMANAGPGTNGSQFFITTVPTPHLDGKHVVFGKVLKGKAVVRALENLETVSDRPVEDAVIAKCGELA 172          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIB_DICDI (Peptidyl-prolyl cis-trans isomerase B OS=Dictyostelium discoideum GN=cypB PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 5.303e-55
Identity = 100/167 (59.88%), Postives = 120/167 (71.86%), Query Frame = 3
Query:   57 KVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            KVFFD+ +  +PAGRIV  L+    P+T ENFRALCTGEKG+G SGKPLHYK S FHR+IP FM Q            ESIYG KF DENF  KH+ PG+LSMANAGP TNGSQFF+ T  T WLDG+H VFG+V+EGMD+VK +E +GS SG  +K   I++ G+L
Sbjct:   31 KVFFDIEIDNKPAGRIVFGLYGKTVPKTVENFRALCTGEKGLGTSGKPLHYKDSKFHRIIPNFMIQGGDFTRGDGTGGESIYGKKFNDENFKIKHSKPGLLSMANAGPNTNGSQFFITTVVTSWLDGRHTVFGEVIEGMDIVKLLESIGSQSGTPSKIAKISNSGEL 197          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIE_RHIOR (Peptidyl-prolyl cis-trans isomerase E OS=Rhizopus oryzae GN=cyp10 PE=3 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.181e-54
Identity = 105/179 (58.66%), Postives = 126/179 (70.39%), Query Frame = 3
Query:   21 FSPINQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            + P ++ +    +V+ D+ +G   AGRI +EL  DV P+TAENFRALCTGE G G       YK SSFHR+IP FMCQ            +SIYG KF DENFV KHTGPG LSMANAG  TNGSQFF+CT KT WLDGKHVVFGQVV GM+VV+ +E+ GS+SG+ +K VVI DCG+L
Sbjct:  144 YIPSSEKRGKKSRVYLDIQIGNTLAGRIEIELRGDVVPKTAENFRALCTGEAGFG-------YKKSSFHRIIPQFMCQGGDFTKGNGTGGKSIYGGKFEDENFVLKHTGPGTLSMANAGSNTNGSQFFICTEKTTWLDGKHVVFGQVVSGMNVVREMERCGSASGKPSKRVVIVDCGEL 315          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_AMAMU (Peptidyl-prolyl cis-trans isomerase D OS=Amanita muscaria GN=Cyp40 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 3.437e-54
Identity = 104/170 (61.18%), Postives = 125/170 (73.53%), Query Frame = 3
Query:   54 PKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNK-PVVIADCGQLS 560
            P VFFD+ +GGQ AGR+   L++D+ P+TAENFRALCTGEKG+G+SGKPL YKGS+FHRVI GFMCQ            ESIYG KF DE F   H+ P +LSMANAGP TNGSQFF+  + T  LDGKHVVFG+V++G  VV+ IE   +++G   K PVVIADCGQLS
Sbjct:    5 PIVFFDIAIGGQLAGRVAFRLYSDLVPKTAENFRALCTGEKGLGQSGKPLWYKGSAFHRVIKGFMCQGGDFTAGNGTGGESIYGEKFEDEGFPVHHSRPFLLSMANAGPNTNGSQFFITVSATPHLDGKHVVFGEVIKGRSVVRTIENNPATNGDVPKEPVVIADCGQLS 174          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA_ECHGR (Peptidyl-prolyl cis-trans isomerase OS=Echinococcus granulosus GN=CYP-1 PE=2 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 3.437e-54
Identity = 107/167 (64.07%), Postives = 123/167 (73.65%), Query Frame = 3
Query:   57 KVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            K FFD+++GG+PAGRIV  LF DV P+T ENFRALCTGEKG G       YKGS FHR+IPGFMCQ            +SIYGSKF DENF  KH+ P +LSMANAG  TNGSQFF+ TA T WLDGKHVVFG+V  G DVVK +E VGSSSG+T++ V+I DCGQL
Sbjct:    4 KCFFDISIGGKPAGRIVFALFDDV-PKTVENFRALCTGEKGFG-------YKGSKFHRIIPGFMCQGGDFTAGNGTGGKSIYGSKFEDENFNHKHSKPMMLSMANAGKNTNGSQFFITTAVTSWLDGKHVVFGEVESGEDVVKDMEAVGSSSGKTSQEVLITDCGQL 162          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PAL4A_HUMAN (Peptidylprolyl cis-trans isomerase A-like 4A OS=Homo sapiens GN=PPIAL4A PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.489e-54
Identity = 102/170 (60.00%), Postives = 123/170 (72.35%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQ 554
            M N  +FFD+TV G+P GRI ++ FAD  P+TAENFRAL TGEKG         YKGS FHR+IPGFMCQ            +SIYG KF DEN ++KHTG GILSMANAGP TNGSQFF+CTAKTEWLDGKHV FG+V E +++V+A+E  G  + +T+K + IADCGQ
Sbjct:    1 MVNSVIFFDITVDGKPLGRISIKQFADKIPKTAENFRALSTGEKGF-------RYKGSCFHRIIPGFMCQGGDFTHPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQ 163          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIE_HUMAN (Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.657e-54
Identity = 101/176 (57.39%), Postives = 124/176 (70.45%), Query Frame = 3
Query:   27 PINQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQ 554
            PI +    NP+V+ D+ +G +PAGRI M L +DV P TAENFR LCT EKG G       +KGSSFHR+IP FMCQ            +SIYG KF DENF+ KHTGPG+LSMAN+GP TNGSQFF+   KT+WLDGKHVVFG+V EG+DV++ IE  GS  G+  + V+IADCG+
Sbjct:  131 PIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG-------FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGE 299          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYP6_RHIOR (Peptidyl-prolyl cis-trans isomerase cyp6 OS=Rhizopus oryzae GN=cyp6 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.657e-54
Identity = 100/168 (59.52%), Postives = 117/168 (69.64%), Query Frame = 3
Query:   54 PKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            PKVFFD+ V GQ +GR+  +LF+D  P+TAENFRALCTGEKG G SGKPLHYK S FHR+IPGFM Q            ESIYG  F DENF  KH G G+LSMANAGP TNGSQFF+    T WLDG H VFGQ+V+G  V+  +E+ GS SG  +  + I DCG+L
Sbjct:    7 PKVFFDIAVNGQHSGRMTFKLFSDTVPKTAENFRALCTGEKGKGISGKPLHYKNSYFHRIIPGFMAQGGDFTMGDGRGGESIYGRTFKDENFTLKHKGKGLLSMANAGPNTNGSQFFITFVDTPWLDGNHTVFGQIVDGSKVLDLLEQHGSRSGMPSAKIEITDCGEL 174          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIE_SCHMA (Peptidyl-prolyl cis-trans isomerase E OS=Schistosoma mansoni PE=1 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 2.910e-53
Identity = 100/168 (59.52%), Postives = 121/168 (72.02%), Query Frame = 3
Query:   54 PKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            P+VFFD+ +G   AGRIVMEL +D+ PRTAENFRALCTGE+G G       Y    FHRVIP FMCQ            +SIYG KF DENF  +H G G+LSMAN+GP TNGSQFF+CT K +WLDGKHVVFG+VV+G +VVK +E VGS SG+  +PV+I+ CG+L
Sbjct:  112 PRVFFDIRIGNGDAGRIVMELRSDIVPRTAENFRALCTGERGFG-------YHNCCFHRVIPQFMCQGGDFVKGDGTGGKSIYGRKFDDENFQLRHEGFGVLSMANSGPNTNGSQFFICTTKCDWLDGKHVVFGRVVDGQNVVKKMESVGSKSGKVKEPVIISRCGEL 272          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIE_PONAB (Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.800e-53
Identity = 100/176 (56.82%), Postives = 123/176 (69.89%), Query Frame = 3
Query:   27 PINQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQ 554
            P  +    NP+V+ D+ +G +PAGRI M L +DV P TAENFR LCT EKG G       +KGSSFHR+IP FMCQ            +SIYG KF DENF+ KHTGPG+LSMAN+GP TNGSQFF+   KT+WLDGKHVVFG+V EG+DV++ IE  GS  G+  + V+IADCG+
Sbjct:  131 PAAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG-------FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEARGSKDGKPKQKVIIADCGE 299          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
PPID_RHIOR3.109e-5561.05Peptidyl-prolyl cis-trans isomerase D OS=Rhizopus ... [more]
PPIB_DICDI5.303e-5559.88Peptidyl-prolyl cis-trans isomerase B OS=Dictyoste... [more]
PPIE_RHIOR1.181e-5458.66Peptidyl-prolyl cis-trans isomerase E OS=Rhizopus ... [more]
PPID_AMAMU3.437e-5461.18Peptidyl-prolyl cis-trans isomerase D OS=Amanita m... [more]
PPIA_ECHGR3.437e-5464.07Peptidyl-prolyl cis-trans isomerase OS=Echinococcu... [more]
PAL4A_HUMAN4.489e-5460.00Peptidylprolyl cis-trans isomerase A-like 4A OS=Ho... [more]
PPIE_HUMAN7.657e-5457.39Peptidyl-prolyl cis-trans isomerase E OS=Homo sapi... [more]
CYP6_RHIOR7.657e-5459.52Peptidyl-prolyl cis-trans isomerase cyp6 OS=Rhizop... [more]
PPIE_SCHMA2.910e-5359.52Peptidyl-prolyl cis-trans isomerase E OS=Schistoso... [more]
PPIE_PONAB3.800e-5356.82Peptidyl-prolyl cis-trans isomerase E OS=Pongo abe... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top