DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_HUMAN (40 kDa peptidyl-prolyl cis-trans isomerase OS=Homo sapiens GN=PPID PE=1 SV=3)

HSP 1 Score: 202.216 bits (513), Expect = 2.723e-51
Identity = 101/174 (58.05%), Postives = 121/174 (69.54%), Query Frame = 3
Query:   39 SKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKS-GKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            S   NP+VFFD+ +GG+  GRIV+ELFAD+ P+TAENFRALCTGEKGIG + GKPLH+KG  FHR+I  FM Q            ESIYG KF DENF  KH   G+LSMANAG  TNGSQFF+ T  T  LDGKHVVFGQV++G+ V + +E V     +  K  VIA+CG+L
Sbjct:   11 SNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGEL 184          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPH_SCHPO (Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe GN=ppi1 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 6.067e-51
Identity = 100/163 (61.35%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   63 FFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCG 551
            FFD+   GQP GRIV +LF DV P+TA NFRALCTGEKG G       Y GS+FHRVIP FM Q            +SIYG KF DENF  KH  PG+LSMANAGP TNGSQFF+ T  T WLDGKHVVFG+V EGMDVVK +E +GS+SG T   +VI  CG
Sbjct:    5 FFDVIANGQPLGRIVFKLFDDVVPKTAANFRALCTGEKGYG-------YAGSTFHRVIPQFMLQGGDFTRGNGTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNGSQFFITTVVTPWLDGKHVVFGEVTEGMDVVKKVESLGSNSGATRARIVIDKCG 160          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CP20B_ARATH (Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic OS=Arabidopsis thaliana GN=CYP20-2 PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.035e-50
Identity = 106/178 (59.55%), Postives = 125/178 (70.22%), Query Frame = 3
Query:   36 QSKMPNPKVFFDMTVG---GQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSG-RTNKPVVIADCGQL 557
            QSK+ + KV+FD++VG   G+ AGRIV+ L+ D  P+T ENFRALCTGEKG G       YKGS+FHRVI  FM Q            +S+YG  F DENF   H GPG+LSMANAGP TNGSQFF+CT KT WLDG+HVVFGQV+EGM+VVK IE+  +  G R  K VVIADCGQL
Sbjct:   85 QSKITH-KVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFG-------YKGSTFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQFFICTIKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQL 254          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIE_DROME (Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.765e-50
Identity = 99/176 (56.25%), Postives = 120/176 (68.18%), Query Frame = 3
Query:   30 INQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            I +++  NP+VFFD+ +GG  AGRIVM L ADV P+TAENFR LCT E+G G       YKG SFHRVIP FMCQ            +SIYG KF DENF  KH   G LSMAN+G  TNGSQFF+CT KT+WLD KHVVFG V+ G +VV+ +E+ GS SG  ++ +VI  CG+L
Sbjct:  131 IEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYG-------YKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_ASPFU (Peptidyl-prolyl cis-trans isomerase D OS=Aspergillus fumigatus GN=cpr6 PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.765e-50
Identity = 99/173 (57.23%), Postives = 118/173 (68.21%), Query Frame = 3
Query:   54 PKVFFDMTVGGQPAGRIVMEL----FADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            P+V+FD+ +G Q AGRI +EL    F DV P+TAENFRALCTGEKG+GK  KPL YKGS FHRVI  FM Q            ESIYG KF DENF  KH  P +LSMAN+GPGTNGSQFF+ T  T  LDGKHVVFG+V+ G  +V+ IE + + + +    V I DCG+LS
Sbjct:    8 PRVYFDIQIGSQKAGRIALELVRLPFNDVVPKTAENFRALCTGEKGVGKQRKPLSYKGSIFHRVIKQFMIQGGDFTNFNGTGGESIYGEKFPDENFELKHDRPFLLSMANSGPGTNGSQFFITTVPTPHLDGKHVVFGEVINGKSIVRKIENMPTQADKPTTDVTIVDCGELS 180          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPC_YEAST (Peptidyl-prolyl cis-trans isomerase C, mitochondrial OS=Saccharomyces cerevisiae GN=CPR3 PE=1 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 5.136e-50
Identity = 100/175 (57.14%), Postives = 117/175 (66.86%), Query Frame = 3
Query:   33 NQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            N +     KVFFD  V G   GRI  EL+ +V P+TAENFRALCTGEKG G       YKG  FHR+IP FM Q            +SIYGSKFADENFVKKH   G+LSMANAGP TNGSQFF+ T    WLDGKHVVFG+V +GMD+VKAIE  G++SG+    +VI + G+L
Sbjct:   15 NSASRLGKKVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWG-------YKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKAIESYGTASGKPRAEIVIEEAGEL 182          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_ASPOR (Peptidyl-prolyl cis-trans isomerase D OS=Aspergillus oryzae GN=cpr6 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.144e-49
Identity = 95/169 (56.21%), Postives = 118/169 (69.82%), Query Frame = 3
Query:   54 PKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            P+VFFD+ +G +  GRI +EL   + P+TAENFRALCTGEKG+GK GKPLH+KGS FHRVI  FM Q            ESIYG KF DENF  KH  P +LSMAN+GPGTNGSQFF+ T  T  LDGKHVVFG+V+ G  VV+ +E + + + +  K V I +CG+L+
Sbjct:    8 PRVFFDIQIGNEKTGRIALELV--LVPKTAENFRALCTGEKGMGKQGKPLHFKGSIFHRVIKQFMIQGGDFTAFNGTGGESIYGEKFPDENFELKHDKPFLLSMANSGPGTNGSQFFITTVPTPHLDGKHVVFGEVINGKSVVRKVENMNTQADKPVKDVTIVECGELT 174          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIH_NEUCR (Peptidyl-prolyl cis-trans isomerase H OS=Neurospora crassa GN=cyp-3 PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.494e-49
Identity = 101/173 (58.38%), Postives = 118/173 (68.21%), Query Frame = 3
Query:   51 NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSK-FADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKP---VVIADCGQL 557
            NP VFFD+T+GG+P GRI  ELF DV PRTAENFR  CTGE      G+P  YKGS FHR+IP FMCQ              IYG+K FADENF+ KH  PG+LSMANAGP TNGSQFF+ T  T +LDGKHVVFG+VV+GMDVVK +E   +     + P   VVIA CG++
Sbjct:   11 NPLVFFDITLGGEPLGRITFELFKDVVPRTAENFRQFCTGESK-NNLGRPQGYKGSKFHRIIPNFMCQGGDFLNGDGTGSTCIYGTKSFADENFLLKHDTPGLLSMANAGPNTNGSQFFITTVPTPFLDGKHVVFGKVVDGMDVVKKMENTKTGYRGKDVPNLDVVIAQCGEM 182          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_DICDI (Peptidyl-prolyl cis-trans isomerase D, mitochondrial OS=Dictyostelium discoideum GN=cypD PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.494e-49
Identity = 102/168 (60.71%), Postives = 115/168 (68.45%), Query Frame = 3
Query:   57 KVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSS-SGRTNKPVVIADCGQL 557
            KVFF +  G  P GR+V EL+ D+ P+TAENFRALCTGEKGIGKSGKPLHYKGSSFHRVI  FM Q            ESIYG  F DENF+ KH   G LSMANAG  TNGSQFF+ TA+T  L+G H VFG+VVEG D+VK +E   +  S R     VI DCGQL
Sbjct:    8 KVFFQIKQGNTPLGRVVFELYNDIVPKTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIKNFMVQGGDFTHGTGIGGESIYGRTFNDENFLVKHK-IGCLSMANAGKNTNGSQFFITTAETPHLNGGHTVFGEVVEGFDIVKKVENAETDRSDRPKAACVIEDCGQL 174          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPH_YEAST (Peptidyl-prolyl cis-trans isomerase OS=Saccharomyces cerevisiae GN=CPR1 PE=1 SV=3)

HSP 1 Score: 196.438 bits (498), Expect = 1.494e-49
Identity = 95/167 (56.89%), Postives = 114/167 (68.26%), Query Frame = 3
Query:   57 KVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            +V+FD+   GQP GR+V +L+ D+ P+TAENFRALCTGEKG G       Y GS FHRVIP FM Q            +SIYG KF DENF K H  PG+LSMANAGP TNGSQFF+ T    WLDGKHVVFG+VV+G D+VK +E +GS SG T   +V+A  G+L
Sbjct:    3 QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG-------YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL 162          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
PPID_HUMAN2.723e-5158.0540 kDa peptidyl-prolyl cis-trans isomerase OS=Homo... [more]
CYPH_SCHPO6.067e-5161.35Peptidyl-prolyl cis-trans isomerase OS=Schizosacch... [more]
CP20B_ARATH1.035e-5059.55Peptidyl-prolyl cis-trans isomerase CYP20-2, chlor... [more]
PPIE_DROME1.765e-5056.25Peptidyl-prolyl cis-trans isomerase E OS=Drosophil... [more]
PPID_ASPFU1.765e-5057.23Peptidyl-prolyl cis-trans isomerase D OS=Aspergill... [more]
CYPC_YEAST5.136e-5057.14Peptidyl-prolyl cis-trans isomerase C, mitochondri... [more]
PPID_ASPOR1.144e-4956.21Peptidyl-prolyl cis-trans isomerase D OS=Aspergill... [more]
PPIH_NEUCR1.494e-4958.38Peptidyl-prolyl cis-trans isomerase H OS=Neurospor... [more]
PPID_DICDI1.494e-4960.71Peptidyl-prolyl cis-trans isomerase D, mitochondri... [more]
CYPH_YEAST1.494e-4956.89Peptidyl-prolyl cis-trans isomerase OS=Saccharomyc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top