DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_DEBHA (Peptidyl-prolyl cis-trans isomerase D OS=Debaryomyces hansenii GN=CPR6 PE=3 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.549e-49
Identity = 98/176 (55.68%), Postives = 121/176 (68.75%), Query Frame = 3
Query:   42 KMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKS-GKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPV---VIADCGQL 557
            K+  PKVFFD++  G+P GR+V EL+ DV P+TAENFRALCTGEKG  +S GK LHYKGS FHR+I  FMCQ            ESIYG KF DENF   H  P +LSMANAG  TNGSQFF+ T  T  L+GKHVVFG+V++G  +V+ +E+     G  +KPV   +I+DCG+L
Sbjct:    4 KLNRPKVFFDISADGKPKGRVVFELYNDVVPKTAENFRALCTGEKGASESSGKQLHYKGSIFHRIIKDFMCQGGDFTHGSGIGGESIYGEKFEDENFQLTHDKPFLLSMANAGANTNGSQFFITTVPTPHLNGKHVVFGEVIQGKSIVRQLER--CDKGENDKPVEDWIISDCGEL 177          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIA2_RHIOR (Peptidyl-prolyl cis-trans isomerase A2 OS=Rhizopus oryzae GN=cyp1 PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 3.329e-49
Identity = 96/166 (57.83%), Postives = 115/166 (69.28%), Query Frame = 3
Query:   60 VFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            V+FD+++ G+PAGRI  +LF DV P+TA+NFRALCTGE+G G       YKGS FHRVIP FM Q            +SIYG KFADENF  KH+ PG+LSMANAGP TNGSQFF+ T    WLDG HVVFG+V + M++V  IE +GS+SG     VVI DCG L
Sbjct:    3 VYFDISIDGKPAGRIEFQLFEDVVPKTAKNFRALCTGEQGFG-------YKGSKFHRVIPQFMLQGGDFTRGDGTGGKSIYGEKFADENFKLKHSEPGLLSMANAGPNTNGSQFFITTVPCSWLDGAHVVFGKVTKNMELVSKIESLGSASGAVKAKVVIEDCGVL 161          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: RBP2_MOUSE (E3 SUMO-protein ligase RANBP2 OS=Mus musculus GN=Ranbp2 PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.652e-48
Identity = 96/173 (55.49%), Postives = 115/173 (66.47%), Query Frame = 3
Query:   39 SKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            SK  NP VFFD+   G+P GRI+MELF+++ P+TAENFRALCTGEKG G       +K S FHRV+P F+CQ            +SIYG KF DENF  KHTGPG+LSMAN G  TN SQFF+   K E LD KHVVFG V +GMD V+ IE  GS  G  ++ + I +CGQL
Sbjct: 2888 SKDTNPVVFFDVCADGEPLGRIIMELFSNIVPQTAENFRALCTGEKGFG-------FKNSIFHRVVPDFICQGGDITKYNGTGGQSIYGDKFDDENFDLKHTGPGLLSMANYGQNTNSSQFFITLKKAEHLDFKHVVFGFVKDGMDTVRKIESFGSPKGSVSRRICITECGQL 3053          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIH_EMENI (Peptidyl-prolyl cis-trans isomerase H OS=Emericella nidulans GN=cyp3 PE=3 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 1.652e-48
Identity = 95/179 (53.07%), Postives = 123/179 (68.72%), Query Frame = 3
Query:   24 SPINQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGS-KFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            S + Q+   NP VFFD+ +GG+P GR+ +ELFADVTPRTAENFR  CTGE    + G+P  YKGS FHRVI  FM Q             +IYG+ KF+DENF  +H  PG+LSMAN+GP TNG QFF+ T  T +L+GKHVVFGQV++GMD+V+ IE   ++  + N+ VVI  CG++
Sbjct:    6 SAVPQTTSSNPIVFFDVALGGEPLGRLKLELFADVTPRTAENFRQFCTGESK-NQQGRPQGYKGSKFHRVIKDFMIQGGDFVNGDGTGSCTIYGTPKFSDENFTLRHDRPGLLSMANSGPNTNGCQFFITTTATPFLNGKHVVFGQVIDGMDIVRMIENTRTTRDKPNQDVVIIQCGEM 183          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CP20C_ARATH (Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic OS=Arabidopsis thaliana GN=CYP20-3 PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.652e-48
Identity = 96/153 (62.75%), Postives = 111/153 (72.55%), Query Frame = 3
Query:   36 QSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIE 494
            Q+K+ N KV+FD+ +GG+ AGRIVM LF +V P+T ENFRALCTGEK  G       YKGSSFHR+I  FM Q             SIYG+KF DENF  KHTGPGILSMANAGP TNGSQFF+CT KT WLD KHVVFGQV+EGM +V+ +E
Sbjct:   90 QAKVTN-KVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYG-------YKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLE 234          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYP40_ARATH (Peptidyl-prolyl cis-trans isomerase CYP40 OS=Arabidopsis thaliana GN=CYP40 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.158e-48
Identity = 98/173 (56.65%), Postives = 120/173 (69.36%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIG-KSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVG-SSSGRTNKPVVIADCGQL 557
            M   K F D+++GG+  GRIV+EL+ DV P+TAENFR LCTGEKG+G  +G PLHYKG+ FHRVI GFM Q            ESIYG KF DENF  KH   G+LSMAN+GP TNGSQFF+ T +T  LDGKHVVFG+V +GM VV++IE V        ++ VVI DCG++
Sbjct:    1 MGRSKCFMDISIGGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNRFHRVIKGFMIQGGDISANDGTGGESIYGLKFDDENFELKHERKGMLSMANSGPNTNGSQFFITTTRTSHLDGKHVVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEI 173          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYP11_RHIOR (Peptidyl-prolyl cis-trans isomerase cyp11 OS=Rhizopus oryzae GN=cyp11 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.818e-48
Identity = 101/173 (58.38%), Postives = 119/173 (68.79%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGK-SGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIE-KVGSSSGRTNKPVVIADCGQL 557
            M NP+VFFD+ V G   GRIV+ELFAD  P+TAENFRALCTGEKGIGK S  PLHYKGS FHR+I GFMCQ            ESIYG+ F DE+F +KH   G+LSMAN GP T  SQFF+ T  T  LDGKHVVFG+VV G +VV+ +E +      R    V+IA+CG+L
Sbjct:    1 MINPRVFFDIDVDGNRIGRIVIELFADQVPKTAENFRALCTGEKGIGKVSNMPLHYKGSIFHRIIKGFMCQGGDFTHRTGKGGESIYGANFPDESFSRKHDTHGLLSMANRGPNTQTSQFFITTRPTPHLDGKHVVFGRVVSGYNVVEMMENEPVDDQDRPLHNVMIANCGEL 173          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_YARLI (Peptidyl-prolyl cis-trans isomerase D OS=Yarrowia lipolytica GN=CPR6 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.681e-48
Identity = 95/172 (55.23%), Postives = 117/172 (68.02%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGS-SSGRTNKPVVIADCGQL 557
            M NP+VFF++ +GG+  G+I  ELFAD  P+TAENFRALCTGEKG  ++G PLH+KGSSFHRVI  FM Q            ESIYG KF DE F   H  P +LSMANAGP TNGSQFF+ T +T  LD KHVVFG+++ G  +V+ IE+  +    R  +PV I DCG+L
Sbjct:    1 MTNPRVFFEVAIGGKTIGKIYFELFADKVPKTAENFRALCTGEKGNTQAGIPLHFKGSSFHRVIKDFMVQGGDFTAGNGTGGESIYGEKFPDEAFPYPHDQPFLLSMANAGPNTNGSQFFITTTETPHLDNKHVVFGKLLSGKGIVRQIERTETGEQDRPKQPVTIVDCGEL 172          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: RBP2_HUMAN (E3 SUMO-protein ligase RANBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 4.807e-48
Identity = 97/173 (56.07%), Postives = 112/173 (64.74%), Query Frame = 3
Query:   39 SKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            SK  NP VFFD+   G+P GRI MELF+++ PRTAENFRALCTGEKG G       +K S FHRVIP F+CQ            +SIYG KF DENF  KHTGPG+LSMAN G  TN SQF +   K E LD KHVVFG V +GMD VK IE  GS  G   + + I +CGQ+
Sbjct: 3059 SKETNPVVFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFG-------FKNSIFHRVIPDFVCQGGDITKHDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQNTNNSQFVITLKKAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVCRRITITECGQI 3224          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: RBP2_BOVIN (E3 SUMO-protein ligase RANBP2 (Fragment) OS=Bos taurus GN=RANBP2 PE=2 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 4.807e-48
Identity = 96/173 (55.49%), Postives = 113/173 (65.32%), Query Frame = 3
Query:   39 SKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            SK  NP VFFD+    +P GRI MELF+++ P+TAENFRALCTGEKG G       +K S FHRVIP F+CQ             SIYG KF DENF  KHTGPG+LSMAN G  TN SQFF+   K E LD KHVVFG V +GMD VK IE  GS  G  ++ ++I +CGQ+
Sbjct:  920 SKETNPVVFFDICADDEPLGRITMELFSNIVPKTAENFRALCTGEKGFG-------FKSSIFHRVIPDFVCQGGDITKHDGTGGRSIYGDKFEDENFDVKHTGPGLLSMANRGQDTNNSQFFITLKKAERLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVSRRIIITECGQI 1085          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
PPID_DEBHA2.549e-4955.68Peptidyl-prolyl cis-trans isomerase D OS=Debaryomy... [more]
PPIA2_RHIOR3.329e-4957.83Peptidyl-prolyl cis-trans isomerase A2 OS=Rhizopus... [more]
RBP2_MOUSE1.652e-4855.49E3 SUMO-protein ligase RANBP2 OS=Mus musculus GN=R... [more]
PPIH_EMENI1.652e-4853.07Peptidyl-prolyl cis-trans isomerase H OS=Emericell... [more]
CP20C_ARATH1.652e-4862.75Peptidyl-prolyl cis-trans isomerase CYP20-3, chlor... [more]
CYP40_ARATH2.158e-4856.65Peptidyl-prolyl cis-trans isomerase CYP40 OS=Arabi... [more]
CYP11_RHIOR2.818e-4858.38Peptidyl-prolyl cis-trans isomerase cyp11 OS=Rhizo... [more]
PPID_YARLI3.681e-4855.23Peptidyl-prolyl cis-trans isomerase D OS=Yarrowia ... [more]
RBP2_HUMAN4.807e-4856.07E3 SUMO-protein ligase RANBP2 OS=Homo sapiens GN=R... [more]
RBP2_BOVIN4.807e-4855.49E3 SUMO-protein ligase RANBP2 (Fragment) OS=Bos ta... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top