DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIH_ASPOR (Peptidyl-prolyl cis-trans isomerase H OS=Aspergillus oryzae GN=cyp3 PE=3 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.386e-47
Identity = 94/176 (53.41%), Postives = 117/176 (66.48%), Query Frame = 3
Query:   33 NQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGS-KFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            + +K PNP VFFD+T+GG+  GRI MELF  +TPRTAENFR  CTGE      G+P  YK S FHRVI  FM Q             +IYG+ +F DENF+ KH  PG+LSMAN+GP TNG QFF+ T  T +L+ KHVVFGQVVEGMDVV+ IE   ++  + N+ V I  CG++
Sbjct:    7 SSAKTPNPVVFFDITLGGESLGRIKMELFTSITPRTAENFRQFCTGESK-SPQGRPQGYKNSKFHRVIKDFMIQGGDFVNGDGTGSRTIYGTPRFQDENFILKHDQPGLLSMANSGPNTNGCQFFITTTATPFLNNKHVVFGQVVEGMDVVRMIENTRTTRDKPNQDVTIIQCGEM 181          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIB_ORPSP (Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyces sp. (strain PC-2) GN=CYPB PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 5.315e-47
Identity = 97/168 (57.74%), Postives = 114/168 (67.86%), Query Frame = 3
Query:   57 KVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSG-RTNKPVVIADCGQL 557
            KV+FD+  G +  GRIV+ L+ +V P+T ENFRAL TGEKG G       YK S FHRVI  FM Q            +SIYG +FADENF  +HTGPGILSMANAG  TNGSQFF+ T  T WLDG+HVVFG+V+EGMDVV AIE   +  G R   PV+IADCG+L
Sbjct:   31 KVYFDIKQGDKDLGRIVLGLYGEVVPKTVENFRALATGEKGYG-------YKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFADENFKLRHTGPGILSMANAGRDTNGSQFFITTVTTSWLDGRHVVFGKVIEGMDVVTAIETTKTLPGDRPATPVIIADCGEL 191          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIH_ASPFU (Peptidyl-prolyl cis-trans isomerase H OS=Aspergillus fumigatus GN=cyp3 PE=3 SV=2)

HSP 1 Score: 187.578 bits (475), Expect = 6.942e-47
Identity = 96/170 (56.47%), Postives = 115/170 (67.65%), Query Frame = 3
Query:   51 NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGS-KFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            NP VFFD+ +GG P GRI MELFADVTPRTAENFR  CTGE      GKP  YK S FHRVI  FM Q             +IYG+ KFADENFV KH   G+LSMAN+GP TNG QFF+ T  T +L+GKHVVFGQVV+GMD+V+ IE   +   + ++ V+I  CG++
Sbjct:   13 NPIVFFDIALGGVPLGRIKMELFADVTPRTAENFRRFCTGESK-NSQGKPQGYKNSKFHRVIKDFMIQGGDFVNGDGTGSCTIYGTPKFADENFVLKHDRAGVLSMANSGPNTNGCQFFITTTATPFLNGKHVVFGQVVDGMDIVRMIENTRTIRDKPSQDVIITQCGEM 181          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIB_CRYNE (Peptidyl-prolyl cis-trans isomerase B OS=Cryptococcus neoformans GN=CPR2 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 6.942e-47
Identity = 100/185 (54.05%), Postives = 123/185 (66.49%), Query Frame = 3
Query:   12 FVFFSPINQSKMP--NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSG-RTNKPVVIADCGQL 557
            FV    ++ +K P    KV+FD+  GG+P GRIVM L+    P+TAENFRAL TG+   G+      Y+GSSFHR+I  FM Q            +SIYGSKF DENF  KHTGPG+LSMANAG  TNGSQFF+CT KT WLD +HVVFG V+EGMDVV A+E V +S G +  +P+ IA  G+L
Sbjct:   29 FVLSPGVDAAKGPVITNKVYFDIEHGGKPLGRIVMGLYGKTVPKTAENFRALATGKNSDGED-LGYGYEGSSFHRIIKNFMIQGGDFTKGDGTGGKSIYGSKFPDENFKLKHTGPGVLSMANAGRDTNGSQFFICTVKTAWLDNRHVVFGHVLEGMDVVYAMENVKTSRGDKPVEPITIAASGEL 212          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIH_HUMAN (Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens GN=PPIH PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 9.066e-47
Identity = 94/179 (52.51%), Postives = 121/179 (67.60%), Query Frame = 3
Query:   30 INQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNK---PVVIADCGQL 557
            +  S   NP VFFD+++GGQ  GR+ +ELFADV P+TAENFR  CTGE    K G P+ YKGS+FHRVI  FM Q             SIY   FADENF  +H+ PG+LSMAN+GP TNG QFF+  +K +WLDGKHVVFG++++G+ V++ IE V   +G  NK   PVVI+ CG++
Sbjct:    3 VANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGE--FRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENV--PTGPNNKPKLPVVISQCGEM 177          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIH_BOVIN (Peptidyl-prolyl cis-trans isomerase H OS=Bos taurus GN=PPIH PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 9.066e-47
Identity = 94/179 (52.51%), Postives = 121/179 (67.60%), Query Frame = 3
Query:   30 INQSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNK---PVVIADCGQL 557
            +  S   NP VFFD+++GGQ  GR+ +ELFADV P+TAENFR  CTGE    K G P+ YKGS+FHRVI  FM Q             SIY   FADENF  +H+ PG+LSMAN+GP TNG QFF+  +K +WLDGKHVVFG++++G+ V++ IE V   +G  NK   PVVI+ CG++
Sbjct:    3 VANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGE--FRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENV--PTGPNNKPKLPVVISQCGEM 177          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIH_GIBZE (Peptidyl-prolyl cis-trans isomerase H OS=Gibberella zeae GN=CYP3 PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.546e-46
Identity = 100/180 (55.56%), Postives = 117/180 (65.00%), Query Frame = 3
Query:   39 SKMP---NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSK-FADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIE--KVG-SSSGRTNKPVVIADCGQL 557
            +K+P   NP VFFD+T+GG+P GRI  ELF DV P+TAENFR  CTGE      G+P  YKGS FHR+IP FMCQ              I+G K F DENF  KH  PG+LSMANAGP TNGSQFF+ T  T +LD KHVVFG+V EGMDVVK +E  K G       N  VVI+ CG++
Sbjct:    4 TKLPESGNPLVFFDITIGGEPLGRITFELFKDVVPKTAENFRQFCTGESKT-PVGRPQGYKGSKFHRIIPNFMCQGGDFLNGDGTGSTCIWGFKSFEDENFTLKHDQPGLLSMANAGPNTNGSQFFITTVPTPFLDNKHVVFGKVFEGMDVVKKMEATKTGYRGKDMPNLDVVISQCGEM 182          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYP11_CAEEL (Peptidyl-prolyl cis-trans isomerase 11 OS=Caenorhabditis elegans GN=cyn-11 PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 4.499e-46
Identity = 97/170 (57.06%), Postives = 113/170 (66.47%), Query Frame = 3
Query:   51 NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNK-PVVIADCGQL 557
            NP VF ++T GG P G IV+ELFADVTPRTAENFR  CTGE    K G P  YK  +FHRVI  FM Q             SIYGSKF DENF  KH GPG+LSMANAG  TNG QFF+  AKT++LD KHVVFG+V++GM  V+ IE V + +    K P+V+  CGQL
Sbjct:   16 NPIVFLEVTAGGAPIGTIVIELFADVTPRTAENFRQFCTGE--YKKDGVPNGYKNCTFHRVIKDFMIQGGDFCNGDGTGLMSIYGSKFRDENFELKHIGPGMLSMANAGSDTNGCQFFITCAKTDFLDNKHVVFGRVLDGMLTVRKIENVPTGANNKPKLPIVVVQCGQL 183          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPIH_CRYNE (Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans GN=CYP3 PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.309e-45
Identity = 95/171 (55.56%), Postives = 119/171 (69.59%), Query Frame = 3
Query:   54 PKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKP---VVIADCGQL 557
            P VFFD+++G  PAGRI MELF D+TP+TAENFR LCTGE  I  +  P  YK ++FHRVIP FM Q             SIYG++F DENF  KHTGPG+LSMAN+GP TNG QFF+ TA  E+LDGKH VFG+V++G+  V+ IE V   +G  N+P   V IA+CG++
Sbjct:   13 PIVFFDISIGDTPAGRIKMELFDDITPKTAENFRQLCTGEHRI--NSVPQGYKKATFHRVIPQFMVQGGDFVRGDGTGSFSIYGAQFEDENFKVKHTGPGLLSMANSGPNTNGCQFFITTAPAEFLDGKHCVFGRVIDGLLTVRKIENV--PTGANNRPKLQVRIAECGEM 179          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: PPID_ASHGO (Peptidyl-prolyl cis-trans isomerase D OS=Ashbya gossypii GN=CPR6 PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.309e-45
Identity = 93/169 (55.03%), Postives = 116/169 (68.64%), Query Frame = 3
Query:   57 KVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGI--GKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            K +FD+++GG+PAGR+V E+++DVTP+TAENF  LC G+ G    K G PL Y+GS FHRVI GFMCQ            ESIYG KF DENF +KH  P +LSMANAGP TNGSQ F+  A T  LDGKHVVFG+V++G  VV+AIE+  +++ R    V I  CG L
Sbjct:    6 KTYFDLSIGGKPAGRVVFEVYSDVTPKTAENFVRLCAGDAGECRTKPGVPLCYQGSLFHRVIKGFMCQFGDFTNGDGTGGESIYGEKFEDENFARKHDRPFLLSMANAGPNTNGSQCFITCAPTPHLDGKHVVFGEVIQGKRVVRAIERQETAADRPLADVRIDACGIL 174          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
PPIH_ASPOR2.386e-4753.41Peptidyl-prolyl cis-trans isomerase H OS=Aspergill... [more]
PPIB_ORPSP5.315e-4757.74Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyc... [more]
PPIH_ASPFU6.942e-4756.47Peptidyl-prolyl cis-trans isomerase H OS=Aspergill... [more]
PPIB_CRYNE6.942e-4754.05Peptidyl-prolyl cis-trans isomerase B OS=Cryptococ... [more]
PPIH_HUMAN9.066e-4752.51Peptidyl-prolyl cis-trans isomerase H OS=Homo sapi... [more]
PPIH_BOVIN9.066e-4752.51Peptidyl-prolyl cis-trans isomerase H OS=Bos tauru... [more]
PPIH_GIBZE1.546e-4655.56Peptidyl-prolyl cis-trans isomerase H OS=Gibberell... [more]
CYP11_CAEEL4.499e-4657.06Peptidyl-prolyl cis-trans isomerase 11 OS=Caenorha... [more]
PPIH_CRYNE1.309e-4555.56Peptidyl-prolyl cis-trans isomerase H OS=Cryptococ... [more]
PPID_ASHGO1.309e-4555.03Peptidyl-prolyl cis-trans isomerase D OS=Ashbya go... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top