DC900257

Overview
NameDC900257
Unique NameDC900257
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length735
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2656 contig Csv1_Contig2656:19..752. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_ASPCL (Protein transport protein sec13 OS=Aspergillus clavatus GN=sec13 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.819e-28
Identity = 71/155 (45.81%), Postives = 97/155 (62.58%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQ-KLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV S+SWAPA APG+L+        Q +  + G DN +K+W         +    L+ HSDWVR VAW+P++ L KS IASASQD TV IWT  A    QW  + L +F T +W VSWS +GN+LAV+  +N V+LWKE + G+W++V  +E
Sbjct:  142 HGMGVNSISWAPAAAPGSLISSNPGPGQQRRFVTGGSDNLLKIWDYNPESKTYNITQTLEGHSDWVRDVAWSPSI-LSKSYIASASQDKTVRIWTSDASNPGQWTSQQL-EFDTVLWRVSWSPSGNILAVSGGDNKVSLWKENLKGQWEKVKDIE 294          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_ASPOR (Protein transport protein sec13 OS=Aspergillus oryzae GN=sec13 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.682e-28
Identity = 69/155 (44.52%), Postives = 97/155 (62.58%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQK-LASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV S+SWAPA +PG+L+        Q+   + G DN +K+W   +     +    L+ HSDWVR VAW+P++ L KS IASASQD TV IWT       QW  + L +F T +W VSWS +GN+LAV+  +N V+LWKE + G+W++V  +E
Sbjct:  141 HGMGVNSISWAPAASPGSLISANPGPGQQRRFVTGGSDNLLKIWDYNSETKSYNLSQTLEGHSDWVRDVAWSPSI-LSKSYIASASQDKTVRIWTSDVSNPGQWASQQL-EFDTVLWRVSWSPSGNILAVSGGDNKVSLWKENLKGQWEKVKDIE 293          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_ASPTN (Protein transport protein sec13 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec13 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.809e-28
Identity = 70/155 (45.16%), Postives = 97/155 (62.58%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQ-KLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV S+SWAPA APG+L+        Q +  + G DN +K+W         +    L+ HSDWVR VAW+P++ L KS IASASQD TV IWT  A    QW  + L +F + +W VSWS +GN+LAV+  +N V+LWKE + G+W++V  +E
Sbjct:  156 HGMGVNSISWAPAAAPGSLISANPGPGQQRRFVTGGSDNLLKIWDYNPETKTYNLSQTLEGHSDWVRDVAWSPSI-LSKSYIASASQDKTVRIWTSDASNPGQWTSQQL-EFDSVLWRVSWSPSGNILAVSGGDNKVSLWKENLKGQWEKVKDIE 308          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_ASPNC (Protein transport protein sec13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec13 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.809e-28
Identity = 71/155 (45.81%), Postives = 97/155 (62.58%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQ-KLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV S+SWAPA APG+L+        Q +  + G DN +K+W         +    L+ HSDWVR VAW+P++ L KS IASASQD TV IWT  A    QW  + L +F T +W VSWS +GN+LAV+  +N V+LWKE + G+W++V  +E
Sbjct:  155 HGMGVNSISWAPAAAPGSLISSNPGPGQQRRFVTGGSDNLLKIWDYNPETKTYNNTQTLEGHSDWVRDVAWSPSV-LSKSYIASASQDKTVRIWTSDASNPGQWTSQQL-EFDTVLWRVSWSPSGNILAVSGGDNKVSLWKENLKGQWEKVKDIE 307          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_ASPFU (Protein transport protein sec13 OS=Aspergillus fumigatus GN=sec13 PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 6.281e-28
Identity = 70/155 (45.16%), Postives = 97/155 (62.58%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQ-KLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV S+SWAPA +PG+L+        Q +  + G DN +K+W         +    L+ HSDWVR VAW+P++ L KS IASASQD TV IWT  A    QW  + L +F T +W VSWS +GN+LAV+  +N V+LWKE + G+W++V  +E
Sbjct:  153 HGMGVNSISWAPAASPGSLISSNPGPGQQRRFVTGGSDNLLKIWDYNPESKTYNLSQTLEGHSDWVRDVAWSPSI-LSKSYIASASQDKTVRIWTSDASNPGQWTSQQL-EFDTVLWRVSWSPSGNILAVSGGDNKVSLWKENLKGQWEKVKDIE 305          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_PICPG (Protein transport protein SEC13 OS=Pichia pastoris (strain GS115) GN=SEC13 PE=3 SV=3)

HSP 1 Score: 124.02 bits (310), Expect = 8.203e-28
Identity = 67/155 (43.23%), Postives = 90/155 (58.06%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTP--VWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV + SWAP   P         D  ++  S GCDN VK+W+  +         A Q HSDWVR VAW+P+  L KS IA+ASQD TV+IWT   +  +WE + L   K P   W  SWSL+GN+LA++  +N VTLWKE + G+W+    V+
Sbjct:  144 HAIGVNAASWAPISLP---------DNTRRFVSGGCDNLVKIWRYDDAAKTFIEEEAFQGHSDWVRDVAWSPSR-LSKSYIATASQDRTVLIWTKDGKSNKWEKQPLTKEKFPDVCWRASWSLSGNVLAISGGDNKVTLWKENIQGKWESAGEVD 288          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_CHAGB (Protein transport protein SEC13 OS=Chaetomium globosum GN=SEC13 PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.117e-27
Identity = 73/159 (45.91%), Postives = 97/159 (61.01%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPV---QKLASCGCDNTVKVWKM--YNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEG-EQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV SVSWAPA  PG++V           ++  + G DN +K+W      G +K++  P L  H+DWVR VAW+P + L KS IASAS+D TV IWT      +QW  +VL  F   VW VSWSL+GN+LA +  +N VTLWKE + GEW+ V  +E
Sbjct:  134 HGLGVNSVSWAPATNPGSIVSSKPSPKSTGNRRFVTGGSDNALKIWAFDAATGAYKLEREP-LTGHTDWVRDVAWSPTV-LQKSYIASASEDRTVRIWTSDPANPQQWNCKVL-GFDAAVWRVSWSLSGNVLAASGGDNKVTLWKENLKGEWECVKSIE 289          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_LODEL (Protein transport protein SEC13 OS=Lodderomyces elongisporus GN=SEC13 PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 6.944e-27
Identity = 67/157 (42.68%), Postives = 93/157 (59.24%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVG--LGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTP--VWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV S SWAP  A  +        L   ++  +CG DN VK+WK    +        L+ H+DWVR VAW+P+  L +  IA+ASQD TV+IWT  K+G+ W+ + L + K P   W  SWSL+GN+LAV+  +N VTLWKE + G+W+    VE
Sbjct:  147 HAIGVNSASWAPFTAASSTSSKDANTLKQHRRFVTCGSDNLVKIWKYDTALETYAEEAKLEGHTDWVRDVAWSPS-NLVRPYIATASQDCTVLIWTQDKDGK-WQSQPLTEEKFPDVCWRCSWSLSGNILAVSGGDNKVTLWKENLQGKWESAGEVE 301          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_COCIM (Protein transport protein SEC13 OS=Coccidioides immitis GN=SEC13 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.547e-26
Identity = 66/155 (42.58%), Postives = 94/155 (60.65%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLG-LLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEG-EQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV SVSWAPA APG+++        +++  + G DN VK+W              L+ H+ WVR V+W+P++ L +S IASASQD TV IWT       +W    L +F   VW VSWSL+GN+LAV+  +N V+LWKE + G+W++V  +E
Sbjct:  151 HGMGVNSVSWAPAAAPGSVISATPSTGQIRRFVTGGSDNLVKIWDYNPETKTYATSHVLEGHTGWVRDVSWSPSI-LSRSYIASASQDKTVRIWTSDPSNPNEWTSHQL-EFDAVVWRVSWSLSGNILAVSGGDNKVSLWKENLKGQWEKVKDIE 303          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_YEAST (Protein transport protein SEC13 OS=Saccharomyces cerevisiae GN=SEC13 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.310e-25
Identity = 65/154 (42.21%), Postives = 90/154 (58.44%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTP--VWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVV 454
            H +GV S SWAPA         G  +  +K  + G DN VK+WK  +          L+ HSDWVR VAW+P + L +S +AS SQD T +IWT   E   W+  +LK+ K P  +W  SWSL+GN+LA++  +N VTLWKE ++G+W+    V
Sbjct:  144 HAIGVNSASWAPATIEEDGEHNGTKES-RKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV-LLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEV 295          
The following BLAST results are available for this feature:
BLAST of DC900257 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
SEC13_ASPCL2.819e-2845.81Protein transport protein sec13 OS=Aspergillus cla... [more]
SEC13_ASPOR3.682e-2844.52Protein transport protein sec13 OS=Aspergillus ory... [more]
SEC13_ASPTN4.809e-2845.16Protein transport protein sec13 OS=Aspergillus ter... [more]
SEC13_ASPNC4.809e-2845.81Protein transport protein sec13 OS=Aspergillus nig... [more]
SEC13_ASPFU6.281e-2845.16Protein transport protein sec13 OS=Aspergillus fum... [more]
SEC13_PICPG8.203e-2843.23Protein transport protein SEC13 OS=Pichia pastoris... [more]
SEC13_CHAGB3.117e-2745.91Protein transport protein SEC13 OS=Chaetomium glob... [more]
SEC13_LODEL6.944e-2742.68Protein transport protein SEC13 OS=Lodderomyces el... [more]
SEC13_COCIM1.547e-2642.58Protein transport protein SEC13 OS=Coccidioides im... [more]
SEC13_YEAST1.310e-2542.21Protein transport protein SEC13 OS=Saccharomyces c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900257 VSS Citrus sinensis cDNA clone VS28601 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900257 ID=DC900257|Name=DC900257|organism=Citrus sinensis|type=EST|length=735bp
CCATCCAGTCGGAGTAACATCTGTTTCATGGGCCCCGGCAATGGCTCCTG
GTGCTTTAGTTGGATTGGGCTTACTGGATCCTGTTCAGAAATTGGCTTCT
TGTGGTTGTGATAATACTGTAAAGGTGTGGAAGATGTATAATGGGATTTG
GAAGATGGATTGCTTCCCTGCCCTTCAGATGCACAGTGATTGGGTGCGGA
GCGTGGCGTGGGCTCCCAACTTGGGTCTTCCAAAATCCACAATTGCAAGT
GCATCACAGGATGGGACAGTTGTTATTTGGACCTGTGCCAAGGAAGGGGA
GCAATGGGAGGGTCGAGTTTTGAAGGATTTTAAGACACCAGTTTGGAGTG
TTTCGTGGTCACTGACTGGAAATTTGTTGGCTGTGGCTGATGCAAATAAT
GTGACATTGTGGAAGGAAGCTGTTGATGGTGAGTGGCAACAAGTGAGTGT
AGTTGAGCCACAGACATAAGGTGTCTTCCTACTTACCCTTTCACAATCAT
TGTGTTCTTTTTTGGACTTATTGGAAGTAGCCTTTCTTACACCTGGTTTA
GTTTTTTTTTTTTCCTTTTTTTTTGGTTGGATTGATTTTGTTGGAATACT
TAATTTGTATTTGGTTAGTTGTTATTCTTTCTTGCCAGATTCAGAAACAA
ATGATGGTGTCTTAATCTCCATATCCATATGTCTGTATTTGTGACTGCCA
ATATTTCTGTTAAATTACATATGAACTCTTTATCC
back to top