DC900257

Overview
NameDC900257
Unique NameDC900257
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length735
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2656 contig Csv1_Contig2656:19..752. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_SCHPO (Protein transport protein sec13 OS=Schizosaccharomyces pombe GN=sec13 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.310e-25
Identity = 67/150 (44.67%), Postives = 89/150 (59.33%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGE-QWEGRVLKDFKTP--VWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQ 439
            H  G  +V W+P    G++VG       +KLA+ GCDN VK+W    G+        L  H DW R VAWAP++GL K+ +ASASQD  V IWT  KEG+  W+   L + K P   W VSWSL+GN+LAV+  +N V L+KE+   +WQ
Sbjct:  144 HEPGCNAVCWSPPSLSGSVVGQSPAAGPKKLATAGCDNLVKIWAFDAGVNNWILEDTLAGHVDWTRDVAWAPSVGLTKTYLASASQDKNVFIWT--KEGDGPWQKTPLTEEKFPDIAWRVSWSLSGNILAVSCGDNKVYLFKES-QNKWQ 290          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_PHANO (Protein transport protein SEC13 OS=Phaeosphaeria nodorum GN=SEC13 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 6.500e-25
Identity = 67/152 (44.08%), Postives = 88/152 (57.89%), Query Frame = 2
Query:   11 GVTSVSWAPAMAPGALVGL--GLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            GV SVSWAPA+APG +V          ++  + G D  VK+W              L  H+DWVR VAW+P + L KS IASASQD TV IWT + +   W+  VL +     W VSWSL+GN+LAV+  +N V+LWKE + G W+ V  +E
Sbjct:  153 GVNSVSWAPAVAPGQVVSASGNQAGAARRFVTGGSDCQVKLWDFSAETGSWQSTQILTGHTDWVRDVAWSPTV-LSKSYIASASQDKTVRIWT-SSDLRDWKSTVL-NVDAVAWRVSWSLSGNVLAVSTGDNRVSLWKERLSGGWECVKTIE 301          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_CANAL (Protein transport protein SEC13 OS=Candida albicans GN=SEC13 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.109e-24
Identity = 63/157 (40.13%), Postives = 94/157 (59.87%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKM--YNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTP--VWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +G  S +WAP            L   +++ SCG DN  K+WK    N  +  +    L+ H+DWVR VAW+P+  L +S IA+ASQD TV+IWT  ++G +W+ ++L + K P   W  SWSL+GN+LAV+  +N V+LWKE + G+W+    V+
Sbjct:  147 HAIGANSATWAPVSTSSK--DSAALKQQRRIVSCGSDNLAKIWKYDAANNTYVEEA--KLEGHTDWVRDVAWSPS-NLIRSYIATASQDRTVLIWTQDRDG-KWQKQLLTEEKFPDVCWRCSWSLSGNILAVSGGDNKVSLWKENLQGKWESAGEVD 297          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_KLULA (Protein transport protein SEC13 OS=Kluyveromyces lactis GN=SEC13 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.891e-24
Identity = 61/158 (38.61%), Postives = 90/158 (56.96%), Query Frame = 2
Query:    2 HPVGVTSVSWAPA----MAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTP--VWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVV 454
            H +G  +  WAPA     +     G      V++  + G DN VK+WK  +          L+ HSDWVR VAW+P + L +S +AS SQD T +IWT   + + W+  +LK+ K P  +W  SWSL+GN+LA++  +N VTLWKE ++G+W+    V
Sbjct:  144 HSIGANTACWAPATLQQQSNQGTSGSASPQQVRRFVTGGADNLVKIWKYNSDAATYLLEHTLEGHSDWVRDVAWSPTV-LSRSYLASVSQDRTCIIWTQDSKEDTWKKTLLKEDKFPDVLWRASWSLSGNILALSCGDNTVTLWKENLEGKWEPAGQV 300          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_ASHGO (Protein transport protein SEC13 OS=Ashbya gossypii GN=SEC13 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 5.502e-24
Identity = 59/155 (38.06%), Postives = 90/155 (58.06%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTP--VWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV +  WAPA              ++++A+ G DN VK+WK             L  H+DWVR VAW+P++ LP++ +A+ SQD T +IWT       W   +LK+ K P  +W  SWSL+GN+LA++  +N VTLWKE ++G+W+  + +E
Sbjct:  144 HAIGVNAACWAPATIED---DGQQSQHLRRIATGGADNLVKIWKYNPEANTYLLEDTLAAHADWVRDVAWSPSV-LPRAYLATVSQDRTCIIWTQENNQGPWTKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKVTLWKENLEGKWESAAEIE 294          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_PICST (Protein transport protein SEC13 OS=Pichia stipitis GN=SEC13 PE=3 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 9.386e-24
Identity = 63/158 (39.87%), Postives = 94/158 (59.49%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGA--LVGLGLLDPVQKLASCGCDNTVKVWKM--YNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTP--VWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVV 454
            H +G  S SWAP  +  +        L   ++  +CG DN  K+WK    N  +  +    L+ H+DWVR VAW+P++ L ++ IA+ASQD TV+IWT  K G +W+ ++L + K P   W  SWSL+GN+LAV+  +N V+LWKE + G+W+    V
Sbjct:  147 HAIGANSASWAPLSSTPSPNQKDAASLKQQRRFVTCGSDNLAKIWKYDAANNTYVEEA--RLEGHTDWVRDVAWSPSM-LVRTYIATASQDRTVLIWTQDKAG-KWQKQLLTEDKFPDVCWRCSWSLSGNILAVSGGDNKVSLWKENLQGKWESAGEV 300          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_DEBHA (Protein transport protein SEC13 OS=Debaryomyces hansenii GN=SEC13 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.601e-23
Identity = 61/155 (39.35%), Postives = 93/155 (60.00%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKD--FKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV S SWAP ++     G    + +++  +CG DN  K+WK  +          L+ H+DWVR V W+P++ L +S IA+ASQD TV+IW+    G+ W+ ++L +  F    W  SWSL+GN+LAV+  +N V+LWKE + G+W+    VE
Sbjct:  147 HAIGVNSASWAP-LSNNNTKGKDT-NSIRRFVTCGSDNLAKIWKFDSSKNAYIEEAVLEGHTDWVRDVCWSPSI-LIRSYIATASQDRTVLIWSQDNNGK-WQKQLLTEEMFPDVCWRCSWSLSGNILAVSGGDNKVSLWKENLQGKWESAGEVE 297          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SC131_CANGA (Protein transport protein SEC13-1 OS=Candida glabrata GN=SEC131 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.091e-23
Identity = 61/154 (39.61%), Postives = 85/154 (55.19%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVL--KDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVV 454
            H +GV + SWAPA   G          V++  + G DN VK+W+             L+ HSDWVR VAW+P++ L +S IAS SQD T  IWT       W    L  ++F   +W  SWSL+GN+LA++  +N VTLWKE ++G+W+    V
Sbjct:  144 HAIGVNAASWAPATVEGGNNPGEAPKEVRRFVTGGADNLVKIWRYNPETQSYLVEDTLEGHSDWVRDVAWSPSV-LLRSYIASVSQDRTCNIWTQEDNTGPWVKTQLTPEEFPDVLWRASWSLSGNILAISGGDNKVTLWKENLNGKWESAGEV 296          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_CRYNE (Protein transport protein SEC13 OS=Cryptococcus neoformans GN=SEC13 PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.785e-22
Identity = 62/166 (37.35%), Postives = 84/166 (50.60%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGL-------LDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVL---------KDFKTPVWSVSWSLTGNLLAVADAN-NVTLWKEAVDGEWQQVS 448
            H  G  ++SWAP++    + G+         L P ++  + G DN +++W       K      ++ H DWVR VAWAPN+GLP   IASASQD TV+I +       W    L           F   VW VSWSL GN+LAV+  +  V+LWKE V   W+ VS
Sbjct:  171 HGTGANAISWAPSVL-STVSGVSRSQQPSNSLAPQKRFVTAGSDNLIRIWGFDEEQKKWTEEETIKGHEDWVRDVAWAPNIGLPGMYIASASQDRTVLIHSRPSPSSSWTSAPLLPSLPQSQDPHFPDAVWRVSWSLAGNVLAVSCGDGKVSLWKEGVGKGWECVS 335          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_PICGU (Protein transport protein SEC13 OS=Pichia guilliermondii GN=SEC13 PE=3 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 1.498e-21
Identity = 60/155 (38.71%), Postives = 86/155 (55.48%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKD--FKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV S SWAP         +    PV++  + G DN  KVW +            L+ H+DWVR V W+P+  L +S IA+ASQD TV+IW    EG+ W+ + L +  F    W  SWS +GN+LAV+  +N V+LWKE + G+W+    V+
Sbjct:  146 HKIGVNSASWAP---------VDTKSPVRRFVTGGSDNLAKVWSLDASKSTYVEEAKLEGHTDWVRDVCWSPS-ALVRSYIATASQDRTVLIWHQDGEGK-WQKQKLTEELFPDVCWRCSWSFSGNILAVSGGDNKVSLWKENLQGKWESAGEVD 289          
The following BLAST results are available for this feature:
BLAST of DC900257 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
SEC13_SCHPO1.310e-2544.67Protein transport protein sec13 OS=Schizosaccharom... [more]
SEC13_PHANO6.500e-2544.08Protein transport protein SEC13 OS=Phaeosphaeria n... [more]
SEC13_CANAL1.109e-2440.13Protein transport protein SEC13 OS=Candida albican... [more]
SEC13_KLULA1.891e-2438.61Protein transport protein SEC13 OS=Kluyveromyces l... [more]
SEC13_ASHGO5.502e-2438.06Protein transport protein SEC13 OS=Ashbya gossypii... [more]
SEC13_PICST9.386e-2439.87Protein transport protein SEC13 OS=Pichia stipitis... [more]
SEC13_DEBHA1.601e-2339.35Protein transport protein SEC13 OS=Debaryomyces ha... [more]
SC131_CANGA2.091e-2339.61Protein transport protein SEC13-1 OS=Candida glabr... [more]
SEC13_CRYNE8.785e-2237.35Protein transport protein SEC13 OS=Cryptococcus ne... [more]
SEC13_PICGU1.498e-2138.71Protein transport protein SEC13 OS=Pichia guillier... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900257 VSS Citrus sinensis cDNA clone VS28601 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900257 ID=DC900257|Name=DC900257|organism=Citrus sinensis|type=EST|length=735bp
CCATCCAGTCGGAGTAACATCTGTTTCATGGGCCCCGGCAATGGCTCCTG
GTGCTTTAGTTGGATTGGGCTTACTGGATCCTGTTCAGAAATTGGCTTCT
TGTGGTTGTGATAATACTGTAAAGGTGTGGAAGATGTATAATGGGATTTG
GAAGATGGATTGCTTCCCTGCCCTTCAGATGCACAGTGATTGGGTGCGGA
GCGTGGCGTGGGCTCCCAACTTGGGTCTTCCAAAATCCACAATTGCAAGT
GCATCACAGGATGGGACAGTTGTTATTTGGACCTGTGCCAAGGAAGGGGA
GCAATGGGAGGGTCGAGTTTTGAAGGATTTTAAGACACCAGTTTGGAGTG
TTTCGTGGTCACTGACTGGAAATTTGTTGGCTGTGGCTGATGCAAATAAT
GTGACATTGTGGAAGGAAGCTGTTGATGGTGAGTGGCAACAAGTGAGTGT
AGTTGAGCCACAGACATAAGGTGTCTTCCTACTTACCCTTTCACAATCAT
TGTGTTCTTTTTTGGACTTATTGGAAGTAGCCTTTCTTACACCTGGTTTA
GTTTTTTTTTTTTCCTTTTTTTTTGGTTGGATTGATTTTGTTGGAATACT
TAATTTGTATTTGGTTAGTTGTTATTCTTTCTTGCCAGATTCAGAAACAA
ATGATGGTGTCTTAATCTCCATATCCATATGTCTGTATTTGTGACTGCCA
ATATTTCTGTTAAATTACATATGAACTCTTTATCC
back to top