DC900254

Overview
NameDC900254
Unique NameDC900254
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length642
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900254_ssr486 microsatellite DC900254_ssr486:486..497. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1669 contig Csv1_Contig1669:758..1399. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_MYCGE (Pyruvate dehydrogenase E1 component subunit beta OS=Mycoplasma genitalium GN=pdhB PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.127e-14
Identity = 46/122 (37.70%), Postives = 67/122 (54.92%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAI 363
            +I EGS++T+V +G  +  +       E +    ELIDL+T+ PWDK+TV  SV+KTGRLL+  EA  +    AEI  S+ E  F  L+    RV G D   PL   E +      +++DA+
Sbjct:  200 LISEGSELTIVSYGPTMFDLINLVYSGELKDKGIELIDLRTISPWDKQTVFNSVKKTGRLLVVTEAVKSFTTSAEIITSVTEELFTYLKKAPQRVTGFDIVVPLARGEKYQFEINARVIDAV 321          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_CYAME (Pyruvate dehydrogenase E1 component subunit beta OS=Cyanidioschyzon merolae GN=pdhB PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.127e-14
Identity = 45/128 (35.16%), Postives = 71/128 (55.47%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTVN 378
            V+REGSD+T++ +   L  + QA      +G++ E+IDL +L P D ET+  SV KT + +I  E   TGG  AE+ A I    F  L+AP+ R+   D P P     E   +    +I++A+K+ ++
Sbjct:  198 VVREGSDVTIITYSRMLHHVMQAVKQLVAQGMNPEVIDLISLKPIDLETLVTSVSKTHKAIIVEECMQTGGIAAEVMAQIYSHAFDELDAPIRRLSSKDVPTPYNGYLEQACLVQPTQIVEAVKTLMS 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ACOB_BACSU (Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta OS=Bacillus subtilis GN=acoB PE=3 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 1.552e-13
Identity = 41/118 (34.75%), Postives = 67/118 (56.78%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKIL 354
            REG+D+TL   G Q++   +A     + GI  E++D ++L P D++ +  S+ KT RL+I  EA        +I+A + ++ F  L+AP+ R+    TP P   V E  Y+PT +KI+
Sbjct:  212 REGNDVTLFAVGKQVNTALEAAAQLSERGIEAEVLDPRSLSPLDEDAIFTSLEKTNRLIIIDEANPRCSIATDIAALVADKGFDLLDAPIKRITAPHTPVPFSPVLEDQYLPTPDKIV 329          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_PORPU (Pyruvate dehydrogenase E1 component subunit beta OS=Porphyra purpurea GN=pdhB PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.647e-13
Identity = 46/128 (35.94%), Postives = 71/128 (55.47%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTVN 378
            V+R+G DIT++ +      + +A      +G   E++DL +L P D +++  SV+KT R+LI  E   T G GAE+ A I E  F  L+APV R+   D P P     E   +   ++I+DA+K+ VN
Sbjct:  197 VVRKGKDITILTYSRMRHHVTEALPLLLNDGYDPEVLDLISLKPLDIDSISVSVKKTHRVLIVEECMKTAGIGAELIAQINEHLFDELDAPVVRLSSQDIPTPYNGSLEQATVIQPHQIIDAVKNIVN 324          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_CAEEL (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Caenorhabditis elegans GN=C04C3.3 PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 5.898e-13
Identity = 42/127 (33.07%), Postives = 70/127 (55.12%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILER-CFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTVN 378
            R G  +T+V +   +    +A    E  G+S E+I+L++L P+D E++  SV KT  L+         G G+EI+A ++E   F +L+AP+ RV G+D P P     E   +PT   ++ A+K ++N
Sbjct:  224 RAGDHVTIVSYSRGVEFSLEAAKQLEAIGVSAEVINLRSLRPFDFESIRQSVHKTHHLVSVETGWPFAGIGSEIAAQVMESDVFDQLDAPLLRVTGVDVPMPYTQTLEAAALPTAEHVVKAVKKSLN 350          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_PORYE (Pyruvate dehydrogenase E1 component subunit beta OS=Porphyra yezoensis GN=pdhB PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.006e-12
Identity = 46/126 (36.51%), Postives = 70/126 (55.56%), Query Frame = 1
Query:    4 IREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTV 375
            +R+G DIT++ +      + QA     KEG   E+IDL +L P D +++  SV+KT ++LI  E   T G GAE+ A I E  F  L+APV R+   D P P     E   +   ++I+D++KS +
Sbjct:  198 VRKGKDITILTYSRMRHHVIQALPALLKEGYDPEVIDLISLKPLDIDSISISVKKTHKVLIVEECMKTAGIGAELIAQINEYLFDELDAPVVRLSSQDIPTPYNGSLEQATVIQPSQIVDSVKSII 323          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_GRATL (Pyruvate dehydrogenase E1 component subunit beta OS=Gracilaria tenuistipitata var. liui GN=pdhB PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.716e-12
Identity = 44/127 (34.65%), Postives = 71/127 (55.91%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIKSTV 375
            ++R+G D+T++ +      + QA +D   +G + E+IDL +L P D  ++  S+ KT +L+I  E   TGG GAEI A I +  F  L+AP+ R+   D P P     E   +    +I++A+KS V
Sbjct:  197 LVRDGLDVTILTYSRMRHHVMQAVVDLVNDGYNPEVIDLISLKPLDITSIAQSLMKTHKLIIVEECMKTGGIGAEIIAQINDNYFDFLDAPIVRLSSQDIPTPYNGKLEKATVIYPQQIIEAVKSIV 323          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_CHAGL (Pyruvate dehydrogenase E1 component subunit beta OS=Chaetosphaeridium globosum GN=pdhB PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.993e-12
Identity = 44/124 (35.48%), Postives = 67/124 (54.03%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPL--VFEPFYMPTKNKILDAIK 366
            V+R G+DIT++ +      + QA      +G   E+ID+ +L P D  T+  SVRKT ++LI  E   TGG GA + A+ILE  F  L+AP+  +   D P P     E   +   N+I+ A++
Sbjct:  197 VVRPGNDITILTYSRMRHHVLQAAKVLVNKGYDPEIIDILSLKPLDMGTISLSVRKTHKVLIVEECMRTGGIGASLRAAILEDLFDYLDAPIQCLSSQDVPTPYSGPLEELTVIQPNQIIQAVE 320          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_YEAST (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Saccharomyces cerevisiae GN=PDB1 PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 8.516e-12
Identity = 44/128 (34.38%), Postives = 71/128 (55.47%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSI-MEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILE-RCFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIKSTVN 378
            REG+DI++V +   +   +E A +  +K G+S E+I+L+++ P D E +  +V+KT  L+       + G GAEI A ++E   F  L+AP+ RV G D P P     E F  P    I+ A+K  ++
Sbjct:  237 REGTDISIVTYTRNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEIVAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVKEVLS 364          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_ASCSU (Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Ascaris suum PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.453e-11
Identity = 44/127 (34.65%), Postives = 64/127 (50.39%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILER-CFLRLEAPVARVCGLDTPFPLV--FEPFYMPTKNKILDAIKSTVN 378
            R G DIT+V     + +   A  +  K GI CE+I+L+ + P D +TV+ SV KT  L+         G GAEISA + E   F  L+ P+ RV G+D P P     E   +P    ++  +K  +N
Sbjct:  233 RPGKDITIVSLSIGVDVSLHAADELAKSGIDCEVINLRCVRPLDFQTVKDSVIKTKHLVTVESGWPNCGVGAEISARVTESDAFGYLDGPILRVTGVDVPMPYAQPLETAALPQPADVVKMVKKCLN 359          
The following BLAST results are available for this feature:
BLAST of DC900254 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
ODPB_MYCGE3.127e-1437.70Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_CYAME3.127e-1435.16Pyruvate dehydrogenase E1 component subunit beta O... [more]
ACOB_BACSU1.552e-1334.75Acetoin:2,6-dichlorophenolindophenol oxidoreductas... [more]
ODPB_PORPU2.647e-1335.94Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_CAEEL5.898e-1333.07Pyruvate dehydrogenase E1 component subunit beta, ... [more]
ODPB_PORYE1.006e-1236.51Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_GRATL1.716e-1234.65Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_CHAGL4.993e-1235.48Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_YEAST8.516e-1234.38Pyruvate dehydrogenase E1 component subunit beta, ... [more]
ODPB_ASCSU1.453e-1134.65Pyruvate dehydrogenase E1 component subunit beta, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900254 VSS Citrus sinensis cDNA clone VS28295 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900254 ID=DC900254|Name=DC900254|organism=Citrus sinensis|type=EST|length=642bp
GTGATTCGAGAAGGCAGTGACATAACACTTGTTGGCTGGGGAGCACAACT
CTCTATCATGGAGCAGGCCTGTTTAGATGCTGAAAAGGAAGGAATTTCTT
GTGAACTGATAGACCTGAAGACACTAATACCATGGGATAAGGAAACAGTA
GAGGCCTCTGTCAGGAAAACCGGACGACTTCTTATTAGCCACGAAGCTCC
GGTTACTGGAGGTTTTGGTGCTGAAATTTCTGCATCTATCCTTGAACGTT
GTTTCTTAAGATTAGAAGCTCCAGTGGCTCGAGTTTGTGGTCTGGACACT
CCCTTCCCTCTCGTTTTCGAACCATTCTACATGCCCACCAAGAATAAGAT
ATTAGATGCAATCAAATCAACTGTAAATTACTAAGAGGGTAACCATCTCT
ACTGCACAACTGCGGATACACAGGTCCAGAGATGAGTGAAATCCCTGCAA
TAGTTTTGCAGGAGGGGAGGTACCAATGTTCCAATACAAACAAACAATAA
GAAAGTTGTATACTCTCCGGAGTTGCTAATTGTTTGTAAACTGGTGGTAA
TGTTATTGGACTGAGCATGCTCACTTACATTCTGCATGTTTGATATGACA
AGTGCAAATGCCATTCTCATCAATGAAGTCCACTCTTTGTTT
back to top