DC900254

Overview
NameDC900254
Unique NameDC900254
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length642
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900254_ssr486 microsatellite DC900254_ssr486:486..497. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1669 contig Csv1_Contig1669:758..1399. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_ZYGCR (Pyruvate dehydrogenase E1 component subunit beta OS=Zygnema circumcarinatum GN=pdhB PE=3 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 4.227e-11
Identity = 39/103 (37.86%), Postives = 59/103 (57.28%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFP 309
            V+R G+DIT++ +      + QA      +G   E+ID+ +L P+D  T+ ASV KT ++LI  E   TGG GA + A+I+E  F  L+AP+  +   D P P
Sbjct:  197 VVRPGNDITILTYSRMRHNVLQATKSLVYKGYDPEIIDIVSLKPFDLGTIGASVCKTHKVLIVEECMRTGGIGATLRAAIMEHFFDYLDAPILCLSSQDVPTP 299          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAPU (Pyruvate dehydrogenase E1 component subunit beta OS=Staurastrum punctulatum GN=pdhB PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.209e-11
Identity = 36/103 (34.95%), Postives = 58/103 (56.31%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFP 309
            ++R G+DIT++ +      + QA      +G   E+ID+ +L P D  T+  S++KT ++LI  E   TGG GA + A+I+E  F  L+AP+  +   D P P
Sbjct:  197 IVRPGTDITILTYSRMRHHVLQATKSLVYKGYDPEIIDIVSLKPVDLGTISTSIKKTHKVLIVEECMRTGGIGASLRATIMEHLFDFLDAPIMCLSSQDVPTP 299          
The following BLAST results are available for this feature:
BLAST of DC900254 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
ODPB_ZYGCR4.227e-1137.86Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_STAPU7.209e-1134.95Pyruvate dehydrogenase E1 component subunit beta O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900254 VSS Citrus sinensis cDNA clone VS28295 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900254 ID=DC900254|Name=DC900254|organism=Citrus sinensis|type=EST|length=642bp
GTGATTCGAGAAGGCAGTGACATAACACTTGTTGGCTGGGGAGCACAACT
CTCTATCATGGAGCAGGCCTGTTTAGATGCTGAAAAGGAAGGAATTTCTT
GTGAACTGATAGACCTGAAGACACTAATACCATGGGATAAGGAAACAGTA
GAGGCCTCTGTCAGGAAAACCGGACGACTTCTTATTAGCCACGAAGCTCC
GGTTACTGGAGGTTTTGGTGCTGAAATTTCTGCATCTATCCTTGAACGTT
GTTTCTTAAGATTAGAAGCTCCAGTGGCTCGAGTTTGTGGTCTGGACACT
CCCTTCCCTCTCGTTTTCGAACCATTCTACATGCCCACCAAGAATAAGAT
ATTAGATGCAATCAAATCAACTGTAAATTACTAAGAGGGTAACCATCTCT
ACTGCACAACTGCGGATACACAGGTCCAGAGATGAGTGAAATCCCTGCAA
TAGTTTTGCAGGAGGGGAGGTACCAATGTTCCAATACAAACAAACAATAA
GAAAGTTGTATACTCTCCGGAGTTGCTAATTGTTTGTAAACTGGTGGTAA
TGTTATTGGACTGAGCATGCTCACTTACATTCTGCATGTTTGATATGACA
AGTGCAAATGCCATTCTCATCAATGAAGTCCACTCTTTGTTT
back to top