DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATW_FELCA (Cathepsin W OS=Felis catus GN=CTSW PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.208e-15
Identity = 62/226 (27.43%), Postives = 93/226 (41.15%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQAN--DGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTG---ECGTEL-NHGVAAVGYGTTLD-----------------GTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNP 624
            C  CWA +    +E +  I   + V LS QEL+DC      GC GG +  AF  +    G+ +E  YP+Q       C ++K+ +    I     +P N +        + P++V I+      + Y +GV       C   L +H V  VG+G +                      +WI++NSWG +WG  GY R+ RG       CGI     YP+      P
Sbjct:  150 CSCCWAMAAAGNIEALWAIKYRQSVELSVQELLDCGRC-GDGCRGGFVWDAFITVLNNSGLASEKDYPFQGQVKPHRC-LAKKRTKVAWIQDFIMLPDNEQKIAWYLATQGPITVTINMKL--LKLYKKGVIEATPTSCDPFLVDHSVLLVGFGKSESVADRRAGAAGAQPQSRRSIPFWILKNSWGTKWGXGGYFRLYRG----NNTCGI---TKYPLTARVDQP 364          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CTSB_DICDI (Cathepsin B OS=Dictyostelium discoideum GN=ctsB PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.190e-15
Identity = 62/203 (30.54%), Postives = 90/203 (44.33%), Query Frame = 1
Query:    1 NSARECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQ--------------ANDGTC--DVSKESSPAVSIDGHENVPA---NHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTEL-NHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRG 549
            N AR CGSCWAF    +      I  N+ V LS  ++V CD   N GC GG    A+ +++K+G V+ E   PY                N  +C  +    SS   S D H+       + ++A+++ +       A      DF  Y  GV+    G +L  H V  VG+G TL+G  Y+   N W   WG+ G   ++RG
Sbjct:  100 NQAR-CGSCWAFGATESATDRLCIHNNENVQLSFMDMVTCDETDN-GCEGGDAFSAWNWLRKQGAVSEEC-LPYTIPTCPPAQQPCLNFVNTPSCTKECQSNSSLIYSQDKHKMAKIYSFDSDEAIMQEIVTNGPVEACFTVFEDFLAYKSGVYVHTTGKDLGGHCVKLVGFG-TLNGVDYYAANNQWTTSWGDNGTFLIKRG 298          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: YCF2E_CAEEL (Uncharacterized peptidase C1-like protein F26E4.3 OS=Caenorhabditis elegans GN=F26E4.3 PE=1 SV=3)

HSP 1 Score: 81.6481 bits (200), Expect = 5.472e-15
Identity = 58/212 (27.36%), Postives = 90/212 (42.45%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVS--LSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGT-------------------CDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFT---------GECGTELNHGVAAVGYG---TTLDGTKYWIVRNSWGPEWGEKGYIRMQRG 549
            +CGS W+ ST A       I++   ++  LS Q+L+ C+  + +GC GG ++ A+ +I+K G V  +  YPY +                       C    + S A  +     V +  ED   + +   PV         DF  Y+ GV+               E  H V  +G+G   +T    KYW+  NSWG +WGE GY ++ RG
Sbjct:  206 DCGSSWSVSTTAISSDRLAIISEGRINSTLSSQQLLSCNQHRQKGCEGGYLDRAWWYIRKLG-VVGDHCYPYVSGQSREPGHCLIPKRDYTNRQGLRCPSGSQDSTAFKMTPPYKVSSREEDIQTELMTNGPVQATFVV-HEDFFMYAGGVYQHSDLAAQKGASSVAEGYHSVRVLGWGVDHSTGKPIKYWLCANSWGTQWGEDGYFKVLRG 415          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATZ_HUMAN (Cathepsin Z OS=Homo sapiens GN=CTSZ PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.146e-15
Identity = 66/193 (34.20%), Postives = 93/193 (48.19%), Query Frame = 1
Query:   16 CGSCWAF-STIAAVEGINHIMTNKLVS--LSEQELVDCDTDQNQG-CNGGLMELAFEFIKKKGGVTTEAKYPYQAND---------GTCDVSKESSPAVSID----GHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTG-ECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRM 540
            CGSCWA  ST A  + IN        S  LS Q ++DC    N G C GG  +L+      + G+  E    YQA D         GTC+  KE     +      G     +  E  + +  A  P+S  I A +     Y+ G++   +  T +NH V+  G+G + DGT+YWIVRNSWG  WGE+G++R+
Sbjct:   89 CGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCG---NAGSCEGG-NDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMA-TERLANYTGGIYAEYQDTTYINHVVSVAGWGIS-DGTEYWIVRNSWGEPWGERGWLRI 275          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATB_MOUSE (Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 9.334e-15
Identity = 65/226 (28.76%), Postives = 96/226 (42.48%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSL---SEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAK------YPY------------------QANDGTCDVSKES--SPAVSIDGH-----ENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELN-HGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAME 588
            CGSCWAF  + A+     I TN  V++   +E  L  C      GCNGG    A+ F  KKG V+           PY                  + +   C+ S E+  SP+   D H      +V  + ++ + +     PV  A     SDF  Y  GV+  E G  +  H +  +G+G   +G  YW+  NSW  +WG+ G+ ++ RG    +  CGI  E
Sbjct:  105 CGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTV-FSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVE-NGVPYWLAANSWNLDWGDNGFFKILRG----ENHCGIESE 324          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CPR1_CAEEL (Gut-specific cysteine proteinase OS=Caenorhabditis elegans GN=cpr-1 PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 2.079e-14
Identity = 66/215 (30.70%), Postives = 85/215 (39.53%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVS--LSEQELVDC-DTDQNQGCNGGLMELAFEFIKKKGGVTTEAKY-----PYQ---ANDGTCDVSKESSPAVSI----------DGHENV-----PANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELN-HGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGI 579
            CGSCWAF     +     I T       +S  +L+ C  +    GC GG    A  +   KG VT    +     PY       G C  SK  S ++S           D H  V     P N      +  A  PV  A      DF  Y  GV+    G  L  H +  +G+GT   G+ YW+V NSWG  WGE G+ ++ RG       CGI
Sbjct:  110 CGSCWAFGAAEMISDRTCIETKGAQQPIISPDDLLSCCGSSCGNGCEGGYPIQALRWWDSKGVVTGGDYHGAGCKPYPIAPCTSGNCPESKTPSCSMSCQSGYSTAYAKDKHFGVSAYAVPKNAASIQAEIYANGPVEAAFSV-YEDFYKYKSGVYKHTAGKYLGGHAIKIIGWGTE-SGSPYWLVANSWGVNWGESGFFKIYRGDDQ----CGI 318          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: TINAG_HUMAN (Tubulointerstitial nephritis antigen OS=Homo sapiens GN=TINAG PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 7.901e-14
Identity = 58/221 (26.24%), Postives = 91/221 (41.18%), Query Frame = 1
Query:   10 RECGSCWAFSTIAAVEGINHIMTNK---LVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPY----QANDGTCDVSKESSPAVSIDGHENVPAN------------------HEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELN---------HGVAAVGYGTTLDGT----KYWIVRNSWGPEWGEKGYIRMQRGISD 558
            + C + WAFST A+V      + +K     +LS Q L+ C      GCN G ++ A+ +++K+G + + A YP      A +  C ++  S         +  P N                  +E  ++K + +     AI     DF  Y  G++     T            H V   G+GT         K+WI  NSWG  WGE GY R+ RG+++
Sbjct:  238 KNCAASWAFST-ASVAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG-LVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQCSPPYRVSSNETEIMKEIMQNGPVQAIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGTLRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNE 456          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: TINAG_BOVIN (Tubulointerstitial nephritis antigen OS=Bos taurus GN=TINAG PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.921e-13
Identity = 59/221 (26.70%), Postives = 93/221 (42.08%), Query Frame = 1
Query:   10 RECGSCWAFST--IAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPY----QANDGTCDVSKES---------SPAVSIDGHEN----------VPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELN---------HGVAAVGYGTTLDGT----KYWIVRNSWGPEWGEKGYIRMQRGISD 558
            + C + WAFST  +AA             +LS Q L+ C   +  GCN G ++ A+ +++K+G + + A YP      A +  C ++  S         +P  +     N          V +N  + + + +   PV  AI     DF  Y  G++     T  +         H V   G+GT         K+WI  NSWG  WGE GY R+ RG+++
Sbjct:  238 KNCAASWAFSTASVAADRIAIQSQGRYTANLSPQNLISCCAKKRHGCNSGSVDRAWWYLRKRG-LVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATTPCPNSIEKSNRIYQCSPPYRVSSNETEIMREIMQNGPVQ-AIMQVHEDFFNYKTGIYRHITSTNEDSEKYRKFRTHAVKLTGWGTLRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNE 456          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATZ_BOVIN (Cathepsin Z OS=Bos taurus GN=CTSZ PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.141e-12
Identity = 59/193 (30.57%), Postives = 86/193 (44.56%), Query Frame = 1
Query:   16 CGSCWAF-STIAAVEGINHIMTNKLVS--LSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSID-------------GHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTE--LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRM 540
            CGSCWA  ST A  + IN        S  LS Q ++DC    +  C GG     +E+  + G +  E    YQA D  CD   +                     G     +  E  + +     P+S  I A +     Y+ G+++ E   +  +NH V+  G+G + DG +YWIVRNSWG  WGE G++R+
Sbjct:   90 CGSCWAHGSTSAMADRINIKRKGAWPSTLLSVQHVIDCGDAGS--CEGGNDLPVWEYAHRHG-IPDETCNNYQAKDQECDKFNQCGTCTEFKECHVIKNYTLWKVGDYGSLSGREKMMAEIYTNGPISCGIMA-TEKMSNYTGGIYS-EYNDQAFINHIVSVAGWGVS-DGMEYWIVRNSWGEPWGEHGWMRI 276          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
CATW_FELCA3.208e-1527.43Cathepsin W OS=Felis catus GN=CTSW PE=2 SV=2[more]
CTSB_DICDI4.190e-1530.54Cathepsin B OS=Dictyostelium discoideum GN=ctsB PE... [more]
YCF2E_CAEEL5.472e-1527.36Uncharacterized peptidase C1-like protein F26E4.3 ... [more]
CATZ_HUMAN7.146e-1534.20Cathepsin Z OS=Homo sapiens GN=CTSZ PE=1 SV=1[more]
CATB_MOUSE9.334e-1528.76Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2[more]
CPR1_CAEEL2.079e-1430.70Gut-specific cysteine proteinase OS=Caenorhabditis... [more]
TINAG_HUMAN7.901e-1426.24Tubulointerstitial nephritis antigen OS=Homo sapie... [more]
TINAG_BOVIN3.921e-1326.70Tubulointerstitial nephritis antigen OS=Bos taurus... [more]
CATZ_BOVIN1.141e-1230.57Cathepsin Z OS=Bos taurus GN=CTSZ PE=2 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top