DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CPR2_ARATH (Probable cysteine proteinase At3g43960 OS=Arabidopsis thaliana GN=At3g43960 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.379e-50
Identity = 102/207 (49.28%), Postives = 134/207 (64.73%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDT-DQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQAND-GTCD-VSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTEL-NHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATN 621
            ECGSCWAF+   AVEGIN I T +LVSLSEQEL+DCD  + N GC GG    AFEFIK+ GG+ ++  Y Y   D   C  +  +++  V+I+GHE VP N E +L KAVA QP+SV I A  ++   Y  GV+ G C     +H V  VGYGT+ D   YW++RNSWGPEWGE GY+R+QR   +  G C +A+   YPIK ++++
Sbjct:  148 ECGSCWAFAATGAVEGINQITTGELVSLSEQELIDCDRGNDNFGCAGGGAVWAFEFIKENGGIVSDEVYGYTGEDTAACKAIEMKTTRVVTINGHEVVPVNDEMSLKKAVAYQPISVMISA--ANMSDYKSGVYKGACSNLWGDHNVLIVGYGTSSDEGDYWLIRNSWGPEWGEGGYLRLQRNFHEPTGKCAVAVAPVYPIKSNSSS 352          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL1_SHEEP (Cathepsin L1 OS=Ovis aries GN=CTSL PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 4.011e-50
Identity = 106/200 (53.00%), Postives = 133/200 (66.50%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVFTG-ECGT-ELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS   A+EG     T KLVSLSEQ LVD    Q NQGCNGGLM+ AF++IK+ GG+ +E  YPY+A D +C+   E S A    G  ++P   E AL+KAVA   P+SVAIDAG S FQFY  G++   +C + +L+HGV  VGYG      K+WIV+NSWGPEWG KGY++M +   D+   CGIA  ASYP
Sbjct:   21 QCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDSSRPQGNQGCNGGLMDNAFQYIKENGGLDSEESYPYEATDTSCNYKPEYSAAKDT-GFVDIP-QREKALMKAVATVGPISVAIDAGHSSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTNNKFWIVKNSWGPEWGNKGYVKMAK---DQNNHCGIATAASYP 215          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: MEX2_JACME (Chymomexicain OS=Jacaratia mexicana PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 4.435e-49
Identity = 90/197 (45.69%), Postives = 124/197 (62.94%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            CGSCWAFST+A VEGIN I T KL+SLSEQEL+DCD  ++ GC GG    + +++   GGV TE +YPY+   G C   ++    V I G++ VPAN E +L++ +  QPVSV  ++    FQ Y  G+F G CG + +H V A+GYG         + +NSWGP WGEKGYI+++R     +G CG+   + +PIK
Sbjct:   22 CGSCWAFSTVATVEGINKIRTGKLISLSEQELLDCDR-RSHGCKGGYQTGSIQYVADNGGVHTEKEYPYEKKQGKCRAKEKKGTKVQITGYKRVPANDEISLIQGIGNQPVSVLHESKGRAFQLYKGGIFNGPCGYKNDHAVTAIGYGKA-----QLLDKNSWGPNWGEKGYIKIKRASGKSEGTCGVYKSSYFPIK 212          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ANAN_ANACO (Ananain OS=Ananas comosus GN=AN1 PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 4.435e-49
Identity = 101/207 (48.79%), Postives = 129/207 (62.32%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPS 636
            CGSCWAF++IA VE I  I    LVSLSEQ+++DC    + GC GG +  A+ FI    GV + A YPY+A  GTC  +   + A  I  +  V  N+E  ++ AV+ QP++ A+DA S +FQ Y  GVFTG CGT LNH +  +GYG    G K+WIVRNSWG  WGE GYIR+ R +S   GLCGIAM+  YP     T  +GPS
Sbjct:  144 CGSCWAFASIATVESIYKIKRGNLVSLSEQQVLDCAV--SYGCKGGWINKAYSFIISNKGVASAAIYPYKAAKGTCKTNGVPNSAY-ITRYTYVQRNNERNMMYAVSNQPIAAALDA-SGNFQHYKRGVFTGPCGTRLNHAIVIIGYGQDSSGKKFWIVRNSWGAGWGEGGYIRLARDVSSSFGLCGIAMDPLYP-----TLQSGPS 341          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL2_HUMAN (Cathepsin L2 OS=Homo sapiens GN=CTSL2 PE=1 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 2.201e-48
Identity = 104/204 (50.98%), Postives = 131/204 (64.22%), Query Frame = 1
Query:   10 RECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGTE-LNHGVAAVGY---GTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            ++CGSCWAFS   A+EG     T KLVSLSEQ LVDC   Q NQGCNGG M  AF+++K+ GG+ +E  YPY A D  C    E+S A +  G   V    E AL+KAVA   P+SVA+DAG S FQFY  G+ F  +C ++ L+HGV  VGY   G   + +KYW+V+NSWGPEWG  GY+++ +   DK   CGIA  ASYP
Sbjct:  133 KQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVA-NDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAK---DKNNHCGIATAASYP 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL1_CERAE (Cathepsin L1 OS=Cercopithecus aethiops GN=CTSL1 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.201e-48
Identity = 104/203 (51.23%), Postives = 134/203 (66.01%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGTE-LNHGVAAVGYG---TTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS   A+EG     T KLVSLSEQ LVDC   Q N+GCNGGLM+ AF+++   GG+ +E  YPY+A + +C  + E S A +  G  ++P   E AL+KAVA   P+SVAIDAG   F FY EG+ F  +C +E ++HGV  VGYG   T  D +KYW+V+NSWG EWG  GYI+M +   D++  CGIA  ASYP
Sbjct:  134 QCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVADNGGLDSEESYPYEATEESCKYNPEYSVA-NDTGFVDIP-KQEKALMKAVATVGPISVAIDAGHESFMFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNSKYWLVKNSWGEEWGMGGYIKMAK---DRRNHCGIASAASYP 331          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL_SARPE (Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 4.903e-48
Identity = 102/199 (51.26%), Postives = 126/199 (63.32%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVFTG-ECGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            CGSCWAFS+  A+EG +      LVSLSEQ LVDC T   N GCNGGLM+ AF +IK  GG+ TE  YPY+  D +C  +K +  A    G  ++P   E+ + KAVA   PVSVAIDA    FQ YSEGV+   EC  + L+HGV  VGYGT   G  YW+V+NSWG  WGE+GYI+M R   ++   CGIA  +SYP
Sbjct:  143 CGSCWAFSSTGALEGQHFRKAGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEGIDDSCHFNKATIGATDT-GFVDIPEGDEEKMKKAVATMGPVSVAIDASHESFQLYSEGVYNEPECDEQNLDHGVLVVGYGTDESGMDYWLVKNSWGTTWGEQGYIKMAR---NQNNQCGIATASSYP 337          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL_DROME (Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 6.404e-48
Identity = 101/200 (50.50%), Postives = 130/200 (65.00%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVFTG-ECGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCWAFS+  A+EG +   +  LVSLSEQ LVDC T   N GCNGGLM+ AF +IK  GG+ TE  YPY+A D +C  +K +  A    G  ++P   E  + +AVA   PVSVAIDA    FQFYSEGV+   +C  + L+HGV  VG+GT   G  YW+V+NSWG  WG+KG+I+M R   +K+  CGIA  +SYP+
Sbjct:  175 CGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATD-RGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLR---NKENQCGIASASSYPL 370          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL1_RAT (Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 6.404e-48
Identity = 102/204 (50.00%), Postives = 134/204 (65.69%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGT-ELNHGVAAVGY---GTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            +CGSCWAFS    +EG   + T KL+SLSEQ LVDC  DQ NQGCNGGLM+ AF++IK+ GG+ +E  YPY+A DG+C    E + A +  G  ++P   E AL+KAVA   P+SVA+DA     QFYS G+ +   C + +L+HGV  VGY   GT  +  KYW+V+NSWG EWG  GYI++ +   D+   CG+A  ASYPI
Sbjct:  134 QCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVA-NDTGFVDIP-QQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKNSWGKEWGMDGYIKIAK---DRNNHCGLATAASYPI 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL1_BOVIN (Cathepsin L1 OS=Bos taurus GN=CTSL1 PE=1 SV=3)

HSP 1 Score: 191.045 bits (484), Expect = 6.404e-48
Identity = 106/204 (51.96%), Postives = 134/204 (65.69%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQAND-GTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGT-ELNHGVAAVGY---GTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS   A+EG     T KLVSLSEQ LVDC   Q NQGCNGGLM+ AF++IK  GG+ +E  YPY A D  +C+   E S A +  G  ++P   E AL+KAVA   P+SVAIDAG + FQFY  G+ +  +C + +L+HGV  VGY   GT  +  K+WIV+NSWGPEWG  GY++M +   D+   CGIA  ASYP
Sbjct:  134 QCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRAQGNQGCNGGLMDNAFQYIKDNGGLDSEESYPYLATDTNSCNYKPECS-AANDTGFVDIP-QREKALMKAVATVGPISVAIDAGHTSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDSNNNKFWIVKNSWGPEWGWNGYVKMAK---DQNNHCGIATAASYP 332          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
CPR2_ARATH1.379e-5049.28Probable cysteine proteinase At3g43960 OS=Arabidop... [more]
CATL1_SHEEP4.011e-5053.00Cathepsin L1 OS=Ovis aries GN=CTSL PE=1 SV=1[more]
MEX2_JACME4.435e-4945.69Chymomexicain OS=Jacaratia mexicana PE=1 SV=1[more]
ANAN_ANACO4.435e-4948.79Ananain OS=Ananas comosus GN=AN1 PE=1 SV=2[more]
CATL2_HUMAN2.201e-4850.98Cathepsin L2 OS=Homo sapiens GN=CTSL2 PE=1 SV=2[more]
CATL1_CERAE2.201e-4851.23Cathepsin L1 OS=Cercopithecus aethiops GN=CTSL1 PE... [more]
CATL_SARPE4.903e-4851.26Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1[more]
CATL_DROME6.404e-4850.50Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=1... [more]
CATL1_RAT6.404e-4850.00Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV... [more]
CATL1_BOVIN6.404e-4851.96Cathepsin L1 OS=Bos taurus GN=CTSL1 PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top