DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL1_PIG (Cathepsin L1 OS=Sus scrofa GN=CTSL1 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.092e-47
Identity = 102/203 (50.25%), Postives = 130/203 (64.04%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGT-ELNHGVAAVGY---GTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS   A+EG     T KLVSLSEQ LVDC   Q NQGCNGGLM+ AF+++K  GG+ TE  YPY   +      K    A +  G  ++P   E AL+KAVA   P+SVAIDAG S FQFY  G+ +  +C + +L+HGV  VGY   GT  + +K+WIV+NSWGPEWG  GY++M +   D+   CGI+  ASYP
Sbjct:  134 QCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGLMDNAFQYVKDNGGLDTEESYPYLGRETNSCTYKPECSAANDTGFVDIP-QREKALMKAVATVGPISVAIDAGHSSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDSNSSKFWIVKNSWGPEWGWNGYVKMAK---DQNNHCGISTAASYP 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL1_HUMAN (Cathepsin L1 OS=Homo sapiens GN=CTSL1 PE=1 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 3.178e-47
Identity = 100/203 (49.26%), Postives = 134/203 (66.01%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGTE-LNHGVAAVGYG---TTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS   A+EG     T +L+SLSEQ LVDC   Q N+GCNGGLM+ AF++++  GG+ +E  YPY+A + +C  + + S A +  G  ++P   E AL+KAVA   P+SVAIDAG   F FY EG+ F  +C +E ++HGV  VGYG   T  D  KYW+V+NSWG EWG  GY++M +   D++  CGIA  ASYP
Sbjct:  134 QCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVA-NDTGFVDIP-KQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAK---DRRNHCGIASAASYP 331          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: MDO1_PSEMR (Macrodontain-1 OS=Pseudananas macrodontes PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 4.151e-47
Identity = 90/195 (46.15%), Postives = 121/195 (62.05%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            CG CWAF+ IA VEGI  I    LV LSEQE++DC    + GC GG +  A++FI    GVTT+  YPY+A  GTC+ +   + A  I G+  V  N E  ++ AV+ QP++  IDA   +FQ+Y  GV++G CG  LNH +  +GYG       YWIVRNSWG  WG+ GY+R++R +S   G+CGIAM   +P
Sbjct:   23 CGGCWAFAAIATVEGIYKIRKGNLVYLSEQEVLDCAV--SYGCKGGWVNRAYDFIISNNGVTTDENYPYRAYQGTCNANYFPNSAY-ITGYSYVRRNDESHMMYAVSNQPIAALIDASGDNFQYYKGGVYSGPCGFSLNHAITIIGYGR----DSYWIVRNSWGSSWGQGGYVRIRRDVSHSGGVCGIAMSPLFP 210          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL2_BOVIN (Cathepsin L2 OS=Bos taurus GN=CTSL2 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 7.080e-47
Identity = 105/204 (51.47%), Postives = 133/204 (65.20%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQAND-GTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGT-ELNHGVAAVGY---GTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS   A+EG     T KLVSLSEQ LVDC   Q NQGCNGGLM+ AF++IK  G + +E  YPY A D  +C+   E S A +  G  ++P   E AL+KAVA   P+SVAIDAG + FQFY  G+ +  +C + +L+HGV  VGY   GT  +  K+WIV+NSWGPEWG  GY++M +   D+   CGIA  ASYP
Sbjct:  134 QCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRAQGNQGCNGGLMDNAFQYIKDNGCLDSEESYPYLATDTNSCNYKPECS-AANDTGFVDIP-QREKALMKAVATVGPISVAIDAGHTSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDSNNNKFWIVKNSWGPEWGWNGYVKMAK---DQNNHCGIATAASYP 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL1_MOUSE (Cathepsin L1 OS=Mus musculus GN=Ctsl1 PE=1 SV=2)

HSP 1 Score: 187.578 bits (475), Expect = 7.080e-47
Identity = 100/204 (49.02%), Postives = 134/204 (65.69%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGTE-LNHGVAAVGY---GTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            +CGSCWAFS    +EG   + T KL+SLSEQ LVDC   Q NQGCNGGLM+ AF++IK+ GG+ +E  YPY+A DG+C    E + A +  G  ++P   E AL+KAVA   P+SVA+DA     QFYS G+ +   C ++ L+HGV  VGY   GT  +  KYW+V+NSWG EWG +GYI++ +   D+   CG+A  ASYP+
Sbjct:  134 QCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVA-NDTGFVDIP-QQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAK---DRDNHCGLATAASYPV 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL1_CANFA (Cathepsin L1 OS=Canis familiaris GN=CTSL1 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.208e-46
Identity = 105/203 (51.72%), Postives = 130/203 (64.04%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQAND-GTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGT-ELNHGVAAVGYG--TTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS   A+EG     T KLVSLSEQ LVDC   Q N+GCNGGLM+ AF ++K  GG+ +E  YPY   D  TC+   E S A +  G  ++P   E AL+KAVA   P+SVAIDAG   FQFY  G+ F  +C + +L+HGV  VGYG   T    K+WIV+NSWGPEWG  GY++M +   D+   CGIA  ASYP
Sbjct:  134 QCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRAQGNEGCNGGLMDNAFRYVKDNGGLDSEESYPYLGRDTETCNYKPECS-AANDTGFVDLP-QREKALMKAVATLGPISVAIDAGHQSFQFYKSGIYFDPDCSSKDLDHGVLVVGYGFEGTDSNNKFWIVKNSWGPEWGWNGYVKMAK---DQNNHCGIATAASYP 331          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP3_HOMAM (Digestive cysteine proteinase 3 OS=Homarus americanus GN=LCP3 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 7.828e-46
Identity = 103/202 (50.99%), Postives = 132/202 (65.35%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANH-EDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTGE-CG-TELNHGVAAVGYGTTLDGTK-YWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS   A+EG + +  ++LVSLSEQ+LVDC TD  N GC GG M  AF++IK  GG+ TE+ YPY+A D +C     S  A+      +V   H E+AL +AV+   P+SVAIDA    FQFYS GV+  + C  T L+HGV AVGYGT  + TK YW+V+NSWG  WG+ GYI+M R   ++   CGIA E SYP
Sbjct:  126 QCGSCWAFSATGALEGQHFLKNDELVSLSEQQLVDCSTDYGNDGCGGGWMTSAFDYIKDNGGIDTESSYPYEAEDRSCRFDANSIGAICTG---SVEVQHTEEALQEAVSGVGPISVAIDASHFSFQFYSSGVYYEQNCSPTFLDHGVLAVGYGT--ESTKDYWLVKNSWGSSWGDAGYIKMSR---NRDNNCGIASEPSYP 319          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP2_HOMAM (Digestive cysteine proteinase 2 OS=Homarus americanus GN=LCP2 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.744e-45
Identity = 96/201 (47.76%), Postives = 127/201 (63.18%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQN-QGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECG-TELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            +CGSCWAFST  ++EG + + T  L+SL+EQ+LVDC      QGCNGG M  AF++IK   G+ TEA YPY+A DG+C     +S A +  GH N+ +  E  L +AV    P+SV IDA  S FQFYS GV +   C  + L+H V AVGYG+   G  +W+V+NSW   WG+ GYI+M R   ++   CGIA  ASYP+
Sbjct:  127 QCGSCWAFSTTGSLEGQHFLKTGSLISLAEQQLVDCSRPYGPQGCNGGWMNDAFDYIKANNGIDTEAAYPYEARDGSCRFD-SNSVAATCSGHTNIASGSETGLQQAVRDIGPISVTIDAAHSSFQFYSSGVYYEPSCSPSYLDHAVLAVGYGSE-GGQDFWLVKNSWATSWGDAGYIKMSR---NRNNNCGIATVASYPL 322          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATS_MOUSE (Cathepsin S OS=Mus musculus GN=Ctss PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 5.074e-45
Identity = 97/200 (48.50%), Postives = 125/200 (62.50%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ---NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTG-ECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            CG+CWAFS + A+EG   + T KL+SLS Q LVDC  ++   N+GC GG M  AF++I   GG+  +A YPY+A D  C  + ++  A +   +  +P   EDAL +AVA K PVSV IDA  S F FY  GV+    C   +NHGV  VGYG TLDG  YW+V+NSWG  +G++GYIRM R   + K  CGIA   SYP
Sbjct:  144 CGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNR-AATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYG-TLDGKDYWLVKNSWGLNFGDQGYIRMAR---NNKNHCGIASYCSYP 338          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATK_CANFA (Cathepsin K OS=Canis familiaris GN=CTSK PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.518e-44
Identity = 95/199 (47.74%), Postives = 127/199 (63.82%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVFTGE-CGTE-LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS++ A+EG     T KL++LS Q LVDC   +N GC GG M  AF++++K  G+ +E  YPY   D +C +   +  A    G+  +P  +E AL +AVA+  P+SVAIDA  + FQFYS+GV+  E C ++ LNH V AVGYG    G K+WI++NSWG  WG KGYI M R   +K   CGIA  AS+P
Sbjct:  136 QCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDC-VSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQDESC-MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPISVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQ-KGNKHWIIKNSWGENWGNKGYILMAR---NKNNACGIANLASFP 328          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
CATL1_PIG1.092e-4750.25Cathepsin L1 OS=Sus scrofa GN=CTSL1 PE=2 SV=1[more]
CATL1_HUMAN3.178e-4749.26Cathepsin L1 OS=Homo sapiens GN=CTSL1 PE=1 SV=2[more]
MDO1_PSEMR4.151e-4746.15Macrodontain-1 OS=Pseudananas macrodontes PE=1 SV=... [more]
CATL2_BOVIN7.080e-4751.47Cathepsin L2 OS=Bos taurus GN=CTSL2 PE=2 SV=1[more]
CATL1_MOUSE7.080e-4749.02Cathepsin L1 OS=Mus musculus GN=Ctsl1 PE=1 SV=2[more]
CATL1_CANFA1.208e-4651.72Cathepsin L1 OS=Canis familiaris GN=CTSL1 PE=2 SV=... [more]
CYSP3_HOMAM7.828e-4650.99Digestive cysteine proteinase 3 OS=Homarus america... [more]
CYSP2_HOMAM1.744e-4547.76Digestive cysteine proteinase 2 OS=Homarus america... [more]
CATS_MOUSE5.074e-4548.50Cathepsin S OS=Mus musculus GN=Ctss PE=2 SV=1[more]
CATK_CANFA2.518e-4447.74Cathepsin K OS=Canis familiaris GN=CTSK PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top