DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ALEUL_ARATH (Thiol protease aleurain-like OS=Arabidopsis thaliana GN=At3g45310 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.957e-42
Identity = 94/202 (46.53%), Postives = 121/202 (59.90%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDC-DTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTGE-CGT---ELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW FST  A+E   H    K +SLSEQ+LVDC  T  N GC+GGL   AFE+IK  GG+ TE  YPY   DG C  S ++   V +    N+    ED L  AV   +PVSVA +    +F+FY +GVFT   CG    ++NH V AVGYG   D   YW+++NSWG EWG+ GY +M+ G    K +CG+A  +SYP+
Sbjct:  162 CGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGTFNNFGCHGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGGCKFSAKNI-GVQVRDSVNITLGAEDELKHAVGLVRPVSVAFEV-VHEFRFYKKGVFTSNTCGNTPMDVNHAVLAVGYGVE-DDVPYWLIKNSWGGEWGDNGYFKMEMG----KNMCGVATCSSYPV 356          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ALEU_HORVU (Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.606e-41
Identity = 94/202 (46.53%), Postives = 121/202 (59.90%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQ-GCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTGE-CGT---ELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW FST  A+E      T K +SLSEQ+LVDC    N  GCNGGL   AFE+IK  GG+ TE  YPY+  +G C    E++ AV +    N+  N ED L  AV   +PVSVA       F+ Y  GV+T + CGT   ++NH V AVGYG   +G  YW+++NSWG +WG+ GY +M+ G    K +C IA  ASYP+
Sbjct:  165 CGSCWTFSTTGALEAAYTQATGKNISLSEQQLVDCAGGFNNFGCNGGLPSQAFEYIKYNGGIDTEESYPYKGVNGVCHYKAENA-AVQVLDSVNITLNAEDELKNAVGLVRPVSVAFQV-IDGFRQYKSGVYTSDHCGTTPDDVNHAVLAVGYGVE-NGVPYWLIKNSWGADWGDNGYFKMEMG----KNMCAIATCASYPV 359          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CRUST_PANBO (Crustapain OS=Pandalus borealis GN=Cys PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.404e-41
Identity = 93/201 (46.27%), Postives = 120/201 (59.70%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVF-TGECGT-ELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            +CGSCWAFS +AA+EG + + T  LVSLSEQ LVDC +   NQGCNGG    A+++I    G+ TE+ YPY+A D  C     +  A ++  +    +  E AL  AV  + PVSV IDAG S F  Y  GV+    C +   NH V AVGYGT  +G  YWIV+NSWG  WGE GYI+M R   ++   C IA  + YP+
Sbjct:  126 QCGSCWAFSAVAALEGAHFLKTGDLVSLSEQNLVDCSSSYGNQGCNGGWPYQAYQYIIANRGIDTESSYPYKAIDDNCRYDAGNIGA-TVSSYVEPASGDESALQHAVQNEGPVSVCIDAGQSSFGSYGGGVYYEPNCDSWYANHAVTAVGYGTDANGGDYWIVKNSWGAWWGESGYIKMAR---NRDNNCAIATYSVYPV 322          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: P34_SOYBN (P34 probable thiol protease OS=Glycine max PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 4.445e-41
Identity = 91/210 (43.33%), Postives = 127/210 (60.48%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENV-------PANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTE---LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSA 615
            CG  WAFS   A+E  + I T  LVSLSEQELVDC  ++++G   G    +FE++ + GG+ T+  YPY+A +G C  +K     V+IDG+E +        +  E A L A+ +QP+SV+IDA   DF  Y+ G++ GE  T    +NH V  VGYG+  DG  YWI +NSWG +WGE GYI +QR   +  G+CG+   ASYP K+ +
Sbjct:  156 CGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDC-VEESEGSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDK-VTIDGYETLIMSDESTESETEQAFLSAILEQPISVSIDA--KDFHLYTGGIYDGENCTSPYGINHFVLLVGYGSA-DGVDYWIAKNSWGFDWGEDGYIWIQRNTGNLLGVCGMNYFASYPTKEES 360          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATS_SAIBB (Cathepsin S OS=Saimiri boliviensis boliviensis GN=CTSS PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 9.903e-41
Identity = 91/198 (45.96%), Postives = 118/198 (59.60%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGV-FTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            CG+CWAFS + A+E    + T KLVSLS Q LVDC     N+GCNGG M  AF++I    G+ +EA YPY+A D  C    +   A +   +  +P   ED L +AVA K PV V +DA    F  Y  GV +   C  ++NHGV  +GYG  L+G +YW+V+NSWG  +GE+GYIRM R   +K   CGIA   SYP
Sbjct:  136 CGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSEKYGNKGCNGGFMTEAFQYIIDNKGIDSEASYPYKATDQKCQYDSKYR-AATCSKYTELPYGREDVLKEAVANKGPVCVGVDASHPSFFLYRSGVYYDPACTQKVNHGVLVIGYG-DLNGKEYWLVKNSWGSNFGEQGYIRMAR---NKGNHCGIASYPSYP 328          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ORYC_ORYSJ (Oryzain gamma chain OS=Oryza sativa subsp. japonica GN=Os09g0442300 PE=2 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 1.293e-40
Identity = 94/202 (46.53%), Postives = 120/202 (59.41%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQ-GCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTGE-CGT---ELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW FST  ++E      T K VSLSEQ+LVDC T  N  GC+GGL   AFE+IK  GG+ TE  YPY   +G C    E+     +D   N+    ED L  AV   +PVSVA     + F+ Y  GV+T + CGT   ++NH V AVGYG   +G  YW+++NSWG +WG+ GY +M+ G    K +CGIA  ASYPI
Sbjct:  166 CGSCWTFSTTGSLEAAYTQATGKPVSLSEQQLVDCATAYNNFGCSGGLPSQAFEYIKYNGGLDTEEAYPYTGVNGICHYKPENVGVKVLDS-VNITLGAEDELKNAVGLVRPVSVAFQV-INGFRMYKSGVYTSDHCGTSPMDVNHAVLAVGYGVE-NGVPYWLIKNSWGADWGDNGYFKMEMG----KNMCGIATCASYPI 360          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATS_RAT (Cathepsin S OS=Rattus norvegicus GN=Ctss PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 4.915e-40
Identity = 97/201 (48.26%), Postives = 122/201 (60.70%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ---NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAI-DAGSSDFQFYSEGVFTG-ECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            CGSCWAFS   A+EG   + T KLVSLS Q LVDC T++   N+GC GG M  AF++I     + +EA YPY+A D  C +    + A +   +  +P   E+AL +AVA K PVSV I DA  S F  Y  GV+    C   +NHGV  VGYG TLDG  YW+V+NSWG  +G++GYIRM R   + K  CGIA   SYP
Sbjct:  134 CGSCWAFSAEGALEGQLKLKTGKLVSLSAQNLVDCSTEEKYGNKGCGGGFMTEAFQYIIDT-SIDSEASYPYKAMDEKC-LYDPKNRAATCSRYIELPFGDEEALKEAVATKGPVSVGIDDASHSSFFLYQSGVYDDPSCTENMNHGVLVVGYG-TLDGKDYWLVKNSWGLHFGDQGYIRMAR---NNKNHCGIASYCSYP 328          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CFAD_DICDI (Counting factor associated protein D OS=Dictyostelium discoideum GN=cfaD PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.439e-39
Identity = 84/202 (41.58%), Postives = 119/202 (58.91%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDT-DQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVFTGECG----TELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW F +  ++EG N +   +LVSLSEQ+LVDC     +QGC GG    AF+++ + G + TE+ YPY   +G C     +   VSI G+ NV +  E AL  A+A   PV++AIDA   DF++Y  GV+          +L+H V A+GYG T  G  Y++V+NSW   WG  GY+ M R   +   LCG++ +A+YPI
Sbjct:  330 CGSCWTFGSTGSLEGTNCVTNGELVSLSEQQLVDCAILTGSQGCGGGFASSAFQYVMEIGSLATESNYPYLMQNGLCRDRTVTPSGVSITGYVNVTSGSESALQNAIATTGPVAIAIDASVDDFRYYMSGVYNNPACKNGLDDLDHEVLAIGYG-TYQGQDYFLVKNSWSTNWGMDGYVYMAR---NDNNLCGVSSQATYPI 527          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATM_MOUSE (Cathepsin M OS=Mus musculus GN=Ctsm PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.439e-39
Identity = 95/202 (47.03%), Postives = 121/202 (59.90%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGVF-TGECGT-ELNHGVAAVGYGTT---LDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            C SCWAFS   A+EG     T +L+ LS Q LVDC   Q N GC  G   LA  ++ + GG+ +EA YPY+  DG+C  S E+S A +I G E VP N EDAL+ AVA   P+SVAIDA  + F FY  G++    C +  + H +  VGYG T    DG KYW+V+NS G +WG KGY+++ R   DK   CGIA  A YP
Sbjct:  135 CNSCWAFSVTGAIEGQMFRKTGQLIPLSVQNLVDCSRPQGNWGCYLGNTYLALHYVMENGGLESEATYPYEEKDGSCRYSPENSTA-NITGFEFVPKN-EDALMNAVASIGPISVAIDARHASFLFYKRGIYYEPNCSSCVVTHSMLLVGYGFTGRESDGRKYWLVKNSMGTQWGNKGYMKISR---DKGNHCGIATYALYP 331          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: TEST2_RAT (Testin-2 OS=Rattus norvegicus GN=Testin PE=1 SV=2)

HSP 1 Score: 162.155 bits (409), Expect = 3.186e-39
Identity = 87/203 (42.86%), Postives = 122/203 (60.10%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDC-DTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGEC-GTELNHGVAAVGY---GTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            C S WAFS   ++EG     T +L+ LSEQ L+DC  ++   GC+GG M+ AF+++K  GG+ TE  YPY+     C    E+S A ++     +P + E+AL+KAVAK  P+SVA+DA    FQFY  G+ +  +C    LNH V  VGY   G   DG  +W+V+NSWG EWG KGY+++ +   D    CGIA  ++YPI
Sbjct:  135 CASSWAFSATGSLEGQMFRKTERLIPLSEQNLLDCMGSNVTHGCSGGFMQYAFQYVKDNGGLATEESYPYRGQGRECRYHAENS-AANVRDFVQIPGS-EEALMKAVAKVGPISVAVDASHGSFQFYGSGIYYEPQCKRVHLNHAVLVVGYGFEGEESDGNSFWLVKNSWGEEWGMKGYMKLAK---DWSNHCGIATYSTYPI 332          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
ALEUL_ARATH8.957e-4246.53Thiol protease aleurain-like OS=Arabidopsis thalia... [more]
ALEU_HORVU2.606e-4146.53Thiol protease aleurain OS=Hordeum vulgare PE=2 SV... [more]
CRUST_PANBO3.404e-4146.27Crustapain OS=Pandalus borealis GN=Cys PE=1 SV=1[more]
P34_SOYBN4.445e-4143.33P34 probable thiol protease OS=Glycine max PE=1 SV... [more]
CATS_SAIBB9.903e-4145.96Cathepsin S OS=Saimiri boliviensis boliviensis GN=... [more]
ORYC_ORYSJ1.293e-4046.53Oryzain gamma chain OS=Oryza sativa subsp. japonic... [more]
CATS_RAT4.915e-4048.26Cathepsin S OS=Rattus norvegicus GN=Ctss PE=2 SV=1[more]
CFAD_DICDI2.439e-3941.58Counting factor associated protein D OS=Dictyostel... [more]
CATM_MOUSE2.439e-3947.03Cathepsin M OS=Mus musculus GN=Ctsm PE=2 SV=1[more]
TEST2_RAT3.186e-3942.86Testin-2 OS=Rattus norvegicus GN=Testin PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top