DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP3_SOLLC (Cysteine proteinase 3 OS=Solanum lycopersicum GN=CYP-3 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.161e-39
Identity = 93/203 (45.81%), Postives = 120/203 (59.11%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDC-DTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTG-ECG---TELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            +CGSCW FST  A+E        K +SLSEQ+LVDC     N GCNGGL   AFE+IK  GG+ TE  YPY   +G C  S +++  V +    N+    E  L  AVA  +PVSVA +     F+ Y  GV+   ECG    ++NH V AVGYG   +GT YW+++NSWG +WGE GY +M+ G    K +CG+A  ASYPI
Sbjct:  159 KCGSCWTFSTTGALEAAYAQAFGKGISLSEQQLVDCAGAFNNFGCNGGLPSQAFEYIKFNGGLDTEEAYPYTGKNGICKFS-QANIGVKVISSVNITLGAEYELKYAVALVRPVSVAFEV-VKGFKQYKSGVYASTECGDTPMDVNHAVLAVGYGVE-NGTPYWLIKNSWGADWGEDGYFKMEMG----KNMCGVATCASYPI 354          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATH_PIG (Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 9.269e-39
Identity = 87/202 (43.07%), Postives = 122/202 (60.40%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTD-QNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTG----ECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW FST  A+E    I T K++SL+EQ+LVDC  +  N GC GGL   AFE+I+   G+  E  YPY+  D  C    + + A  +    N+  N E+A+++AVA   PVS A +  ++DF  Y +G+++     +   ++NH V AVGYG   +G  YWIV+NSWGP+WG  GY  ++RG    K +CG+A  ASYPI
Sbjct:  138 CGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAF-VKDVANITMNDEEAMVEAVALYNPVSFAFEV-TNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEE-NGIPYWIVKNSWGPQWGMNGYFLIERG----KNMCGLAACASYPI 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATH_BOVIN (Cathepsin H OS=Bos taurus GN=CTSH PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.211e-38
Identity = 88/202 (43.56%), Postives = 119/202 (58.91%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTD-QNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTG----ECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW FST  A+E    I T KL  L+EQ+LVDC  +  N GC GGL   AFE+I+   G+  E  YPY+  DG C   + S     +    N+  N E+A+++AVA   PVS A +  ++DF  Y +G+++     +   ++NH V AVGYG    G  YWIV+NSWGP WG KGY  ++RG    K +CG+A  AS+PI
Sbjct:  138 CGSCWTFSTTGALESAVAIATGKLPFLAEQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYRGQDGDCKY-QPSKAIAFVKDVANITLNDEEAMVEAVALHNPVSFAFEV-TADFMMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEE-KGIPYWIVKNSWGPNWGMKGYFLIERG----KNMCGLAACASFPI 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: TEST2_MOUSE (Testin-2 OS=Mus musculus PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.065e-38
Identity = 90/203 (44.33%), Postives = 119/203 (58.62%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDC-DTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQ-PVSVAIDAGSSDFQFYSEGVF-TGECG-TELNHGVAAVGYG---TTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            C S WAFS   ++EG     T +LV LSEQ L+DC  ++    C+GG M+ AF+++K  GG+ TE  YPY      C    E+S A ++     +P   E+AL+KAVAK  P+SVA+DA    FQFY  G++   +C    LNH V  VGYG      DG  YW+V+NSWG EWG KGYI++ +   D    CGIA  A+YPI
Sbjct:  135 CASSWAFSATGSLEGQMFKKTGRLVPLSEQNLLDCMGSNVTHDCSGGFMQNAFQYVKDNGGLATEESYPYIGPGRKCRYHAENS-AANVRDFVQIPGR-EEALMKAVAKVGPISVAVDASHDSFQFYDSGIYYEPQCKRVHLNHAVLVVGYGFEGEESDGNSYWLVKNSWGEEWGMKGYIKIAK---DWNNHCGIATLATYPI 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATL6_HUMAN (Putative cathepsin L-like protein 6 OS=Homo sapiens GN=CTSLL6 PE=5 SV=3)

HSP 1 Score: 159.073 bits (401), Expect = 2.697e-38
Identity = 92/204 (45.10%), Postives = 123/204 (60.29%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAK-QPVSVAIDAGSSDFQFYSEGV-FTGECGTE-LNHGVAAVGY---GTTLDGTKYWIVRN-SWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAFS   A+EG     T KL+SL+EQ LVDC   Q N+GCNGG M+  F ++++ GG+ +EA YPY+    TC  + + S A +  G  ++P+  +D L KAVA   P+SVA  A    FQFY +G+ F   C  E L+H +  VGY   G   D  KYW+V+N S G  WG  GYI+M +   D++  CGIA  ASYP
Sbjct:   77 QCGSCWAFSATGALEGQMFWKTGKLISLNEQNLVDCSGPQGNEGCNGGFMDNPFRYVQENGGLDSEASYPYEGKVKTCRYNPKYS-AANDTGFVDIPSQEKD-LAKAVATVGPISVAAGASHVSFQFYKKGIYFEPRCDPEGLDHAMLLVGYSYEGADSDNNKYWLVKNSSEGKNWGMDGYIKMAK---DRRNNCGIATAASYP 275          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATLL_FASHE (Cathepsin L-like proteinase OS=Fasciola hepatica GN=Cat-1 PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.522e-38
Identity = 91/200 (45.50%), Postives = 122/200 (61.00%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQ-NQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAV-AKQPVSVAIDAGSSDFQFYSEGVFTGECGTEL--NHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCWAFST   +EG         +S SEQ+LVDC     N GC+GGLME A++++K+ G + TE+ YPY A +G C  +K+   A  + G+  V +  E  L   V A++P +VA+D   SDF  Y  G++  +  + L  NH V AVGYGT   GT YWIV+NSWG  WGE+GYIRM R   ++  +CGIA  AS P+
Sbjct:  129 CGSCWAFSTTGTMEGQYMKNERTSISFSEQQLVDCSGPWGNNGCSGGLMENAYQYLKQFG-LETESSYPYTAVEGQCRYNKQLGVA-KVTGYYTVHSGSEVELKNLVGARRPAAVAVDV-ESDFMMYRSGIYQSQTCSPLRVNHAVLAVGYGTQ-GGTDYWIVKNSWGTYWGERGYIRMAR---NRGNMCGIASLASLPM 321          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATH_HUMAN (Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4)

HSP 1 Score: 158.688 bits (400), Expect = 3.522e-38
Identity = 88/202 (43.56%), Postives = 117/202 (57.92%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTD-QNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVA-KQPVSVAIDAGSSDFQFYSEGVFTG----ECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPI 603
            CGSCW FST  A+E    I T K++SL+EQ+LVDC  D  N GC GGL   AFE+I    G+  E  YPYQ  DG C      +    +    N+    E+A+++AVA   PVS A +  + DF  Y  G+++     +   ++NH V AVGYG   +G  YWIV+NSWGP+WG  GY  ++RG    K +CG+A  ASYPI
Sbjct:  138 CGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGF-VKDVANITIYDEEAMVEAVALYNPVSFAFEV-TQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEK-NGIPYWIVKNSWGPQWGMNGYFLIERG----KNMCGLAACASYPI 332          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATJ_RAT (Cathepsin J OS=Rattus norvegicus GN=Ctsj PE=2 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 1.338e-37
Identity = 82/202 (40.59%), Postives = 114/202 (56.44%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCD-TDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVF-TGECGT-ELNHGVAAVGY---GTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAF+ + A+EG     T  L  LS Q L+DC  ++ N GC  G    AF ++ K  G+  EA YPY+  DG C    E++ A +I G  N+P N     +   +  PVS AIDA    F+FYS GV+    C +  +NH V  VGY   G   DG  YW+++NSWG EWG  G++++ +   D+   CGIA +AS+P
Sbjct:  134 KCGSCWAFAAVGAIEGQMFSKTGNLTPLSVQNLLDCSKSEGNNGCRWGTAHQAFNYVLKNKGLEAEATYPYEGKDGPCRYHSENASA-NITGFVNLPPNELYLWVAVASIGPVSAAIDASHDSFRFYSGGVYHEPNCSSYVVNHAVLVVGYGFEGNETDGNNYWLIKNSWGEEWGINGFMKIAK---DRNNHCGIASQASFP 331          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATJ_MOUSE (Cathepsin J OS=Mus musculus GN=Ctsj PE=2 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 5.086e-37
Identity = 83/202 (41.09%), Postives = 113/202 (55.94%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCD-TDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVF-TGECGTE-LNHGVAAVGYGT---TLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYP 600
            +CGSCWAF+   A+EG     T  L  LS Q L+DC  T  N+GC  G    AFE++ K  G+  EA YPY+  DG C    E++ A +I  + N+P N     +   +  PVS AIDA    F+FY+ G++    C +  +NH V  VGYG+     DG  YW+++NSWG EWG  GY+++ +   D    CGIA  ASYP
Sbjct:  134 KCGSCWAFAAAGAIEGQMFWKTGNLTPLSVQNLLDCSKTVGNKGCQSGTAHQAFEYVLKNKGLEAEATYPYEGKDGPCRYRSENASA-NITDYVNLPPNELYLWVAVASIGPVSAAIDASHDSFRFYNGGIYYEPNCSSYFVNHAVLVVGYGSEGDVKDGNNYWLIKNSWGEEWGMNGYMQIAK---DHNNHCGIASLASYP 331          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CATV_GVXN (Viral cathepsin OS=Xestia c-nigrum granulosis virus GN=VCATH PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 6.643e-37
Identity = 89/193 (46.11%), Postives = 113/193 (58.55%), Query Frame = 1
Query:   10 RECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAV-AKQPVSVAIDAGSSDFQFYSEGVFTGECGTE--LNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGI 579
            +ECGSCWAFS +A +E + HI  N  + LSEQ+LVDCD   N GCNGGLM  AFE I + GG++ EA YPY   DG C   K ++  V + G        E  L + +  K PVSVAID    D   Y  GV    C  +  LNHGV  VGYG   D  KYW ++NSWG +WGE+G+ R++R ++     CGI
Sbjct:  152 KECGSCWAFSAVANIESLYHIKHNVSLDLSEQQLVDCD-KVNNGCNGGLMSWAFEGIIRAGGISYEAPYPYTGVDGVC---KNTTRYVQLSGCYAYDLRSEKKLRQVLHEKGPVSVAIDV--VDLTNYKSGV-AKHCSVDHGLNHGVLLVGYGQEND-VKYWTLKNSWGSDWGEQGFFRIKRDVNS----CGI 332          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
CYSP3_SOLLC4.161e-3945.81Cysteine proteinase 3 OS=Solanum lycopersicum GN=C... [more]
CATH_PIG9.269e-3943.07Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1[more]
CATH_BOVIN1.211e-3843.56Cathepsin H OS=Bos taurus GN=CTSH PE=2 SV=1[more]
TEST2_MOUSE2.065e-3844.33Testin-2 OS=Mus musculus PE=2 SV=1[more]
CATL6_HUMAN2.697e-3845.10Putative cathepsin L-like protein 6 OS=Homo sapien... [more]
CATLL_FASHE3.522e-3845.50Cathepsin L-like proteinase OS=Fasciola hepatica G... [more]
CATH_HUMAN3.522e-3843.56Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4[more]
CATJ_RAT1.338e-3740.59Cathepsin J OS=Rattus norvegicus GN=Ctsj PE=2 SV=2[more]
CATJ_MOUSE5.086e-3741.09Cathepsin J OS=Mus musculus GN=Ctsj PE=2 SV=2[more]
CATV_GVXN6.643e-3746.11Viral cathepsin OS=Xestia c-nigrum granulosis viru... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top