DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.521e-58
Identity = 115/136 (84.56%), Postives = 123/136 (90.44%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELE  PKFLKNGDAG+VKMIPTKPMVVETF+ YPPLGRFAVRDMRQTVAVGVIK VEKKDPTG
Sbjct:  301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEALPKFLKNGDAGIVKMIPTKPMVVETFATYPPLGRFAVRDMRQTVAVGVIKGVEKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.521e-58
Identity = 114/136 (83.82%), Postives = 125/136 (91.91%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF++YPPLGRFAVR MRQTVAVGVIK VEKKDPTG
Sbjct:  301 KNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRVMRQTVAVGVIKAVEKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.859e-56
Identity = 110/136 (80.88%), Postives = 121/136 (88.97%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AANFT+QVIIMNHPGQI NGYAPVLDCHTSHIAVKF+E+ TKIDRRSGKELE  PKFLKNGDAG VKMIPTKPMVVETF+ YPPLGRFAVRDMRQTVAVGVIK+VEKK+PTG
Sbjct:  301 KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQISNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKELEAAPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.859e-56
Identity = 110/136 (80.88%), Postives = 121/136 (88.97%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AANFT+QVIIMNHPGQI NGYAPVLDCHTSHIAVKF+E+ TKIDRRSGKELE  PKFLKNGDAG VKMIPTKPMVVETF+ YPPLGRFAVRDMRQTVAVGVIK+VEKK+PTG
Sbjct:  301 KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQISNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKELEAAPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_TRYBB (Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=1 SV=3)

HSP 1 Score: 193.356 bits (490), Expect = 1.093e-48
Identity = 95/136 (69.85%), Postives = 115/136 (84.56%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DP + AA+FT+QVII+NHPGQIGNGYAPVLDCHTSHIA KF+E+ +KIDRRSGKELEK PK +K+GDA +V+M+P KPM VE F+DY PLGRFAVRDMRQTVAVG+IK V KKD +G
Sbjct:  301 KNVSVKDIRRGNVCGNTKNDPPKEAADFTAQVIILNHPGQIGNGYAPVLDCHTSHIACKFAEIESKIDRRSGKELEKAPKSIKSGDAAIVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVTKKDGSG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ABSGL (Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.434e-48
Identity = 94/136 (69.12%), Postives = 115/136 (84.56%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DPA+ A +FT+QVI++NHPGQIG GYAPVLDCHT+HIA KF+EL+ KIDRRSGK+LE  PKF+K+GD+ +VKMIP+KPM VE ++DYPPLGRFAVRDMRQTVAVGVIK VEK D  G
Sbjct:  311 KNVSVKDIRRGNVCSDSKNDPAKEAGSFTAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFAELLEKIDRRSGKKLEDAPKFVKSGDSAIVKMIPSKPMCVEAYTDYPPLGRFAVRDMRQTVAVGVIKAVEKVDKAG 446          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-2 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.179e-48
Identity = 93/136 (68.38%), Postives = 115/136 (84.56%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DPA+ +A+FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFSEL+ KIDRRSGK++E  PKF+K+GD+ +VKM+P+KPM VE ++DYPPLGRFAVRDMRQTVAVGVIK VEK D  G
Sbjct:  311 KNVSVKDIRRGNVCSDSKNDPAKESASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFSELIEKIDRRSGKKMEDSPKFVKSGDSAIVKMVPSKPMCVEAYTDYPPLGRFAVRDMRQTVAVGVIKAVEKVDKAG 446          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-1 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.179e-48
Identity = 93/136 (68.38%), Postives = 115/136 (84.56%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DPA+ +A+FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFSEL+ KIDRRSGK++E  PKF+K+GD+ +VKM+P+KPM VE ++DYPPLGRFAVRDMRQTVAVGVIK VEK D  G
Sbjct:  311 KNVSVKDIRRGNVCSDSKNDPAKESASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFSELIEKIDRRSGKKMEDSPKFVKSGDSAIVKMVPSKPMCVEAYTDYPPLGRFAVRDMRQTVAVGVIKAVEKVDKAG 446          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_COCIM (Elongation factor 1-alpha OS=Coccidioides immitis GN=TEF PE=2 SV=2)

HSP 1 Score: 186.808 bits (473), Expect = 1.023e-46
Identity = 88/134 (65.67%), Postives = 109/134 (81.34%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K V +G+  G     K+DP +   +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KFSEL+ KIDRR+GK +E  PKF+K+GDA +VKM+P+KPM VE F+DYPPLGRFAVRDMRQTVAVGVIK+VEK + TG
Sbjct:  317 KEVRRGNVAG---DSKNDPPKGCDSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLEKIDRRTGKSVENNPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVEKSEKTG 447          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A3_XENLA (Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 1.336e-46
Identity = 92/130 (70.77%), Postives = 108/130 (83.08%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K++ +G+  G     K+DP   A +FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE +PKFLK+GDA +V+MIP KPM VETFSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDIRRGNVAG---DSKNDPPMQAGSFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKQKIDRRSGKKLEDDPKFLKSGDAAIVEMIPGKPMCVETFSDYPPLGRFAVRDMRQTVAVGVIKGVDKK 444          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A_WHEAT1.521e-5884.56Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A1_DAUCA1.521e-5883.82Elongation factor 1-alpha OS=Daucus carota PE=3 SV... [more]
EF1A2_HORVU1.859e-5680.88Elongation factor 1-alpha OS=Hordeum vulgare GN=BL... [more]
EF1A1_HORVU1.859e-5680.88Elongation factor 1-alpha OS=Hordeum vulgare PE=1 ... [more]
EF1A_TRYBB1.093e-4869.85Elongation factor 1-alpha OS=Trypanosoma brucei br... [more]
EF1A_ABSGL2.434e-4869.12Elongation factor 1-alpha OS=Absidia glauca GN=TEF... [more]
EF1A2_RHIRA3.179e-4868.38Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]
EF1A1_RHIRA3.179e-4868.38Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]
EF1A_COCIM1.023e-4665.67Elongation factor 1-alpha OS=Coccidioides immitis ... [more]
EF1A3_XENLA1.336e-4670.77Elongation factor 1-alpha, oocyte form OS=Xenopus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top