DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_OSCTI (Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.336e-46
Identity = 88/134 (65.67%), Postives = 111/134 (82.84%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K++ +GS   +C   K+DPA+ + +FT+QVI+MNHPGQIG GY PVLDCHT+HIA KF+EL  K+DRR+GK++E  PKFLK+GDAG+V++IPTKP+ VE F+DY PLGRFAVRDMRQTVAVGVIK V K D +G
Sbjct:  318 KDIRRGS---VCSDSKNDPAKESKSFTAQVIVMNHPGQIGAGYTPVLDCHTAHIACKFAELKEKVDRRTGKKVEDPPKFLKSGDAGIVELIPTKPLCVEAFTDYAPLGRFAVRDMRQTVAVGVIKGVTKDDGSG 448          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A0_XENLA (Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.336e-46
Identity = 94/130 (72.31%), Postives = 107/130 (82.31%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   A +FT+QVII+NHPGQIG GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V MIP KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK VEKK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAGSFTAQVIILNHPGQIGAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKFLKSGDAAIVDMIPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVEKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_CANAL (Elongation factor 1-alpha OS=Candida albicans GN=TEF1 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.744e-46
Identity = 90/136 (66.18%), Postives = 111/136 (81.62%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DP +   +F +QVI++NHPGQI  GY+PVLDCHT+HIA KF  LV KIDRR+GK+LE+ PKF+K+GDA +VKM+PTKPM VE F+DYPPLGRFAVRDMRQTVAVGVIK+VEK D  G
Sbjct:  311 KNVSVKEIRRGNVCGDSKNDPPKGCDSFNAQVIVLNHPGQISAGYSPVLDCHTAHIACKFDTLVEKIDRRTGKKLEENPKFVKSGDAAIVKMVPTKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVEKSDKAG 446          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_CAEEL (Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.744e-46
Identity = 89/131 (67.94%), Postives = 109/131 (83.21%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKD 409
            K++ +GS   +C   K DPA+ A  F +QVIIMNHPGQI NGY PVLDCHT+HIA KF+EL  K+DRR+GK++E  PKFLK+GDAG+V++IPTKP+ VE+F+DY PLGRFAVRDMRQTVAVGVIK+VEK D
Sbjct:  318 KDIRRGS---VCSDSKQDPAKEARTFHAQVIIMNHPGQISNGYTPVLDCHTAHIACKFNELKEKVDRRTGKKVEDFPKFLKSGDAGIVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVEKSD 445          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_OSCTI (Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.278e-46
Identity = 88/134 (65.67%), Postives = 111/134 (82.84%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K++ +GS   +C   K+DPA+ + +FT+QVI+MNHPGQIG GY PVLDCHT+HIA KF+EL  K+DRR+GK++E  PKFLK+GDAG+V++IPTKP+ VE F+DY PLGRFAVRDMRQTVAVGVIK V K D +G
Sbjct:  318 KDIRRGS---VCSDSKNDPAKESKSFTAQVIVMNHPGQIGAGYTPVLDCHTAHIACKFAELKEKVDRRTGKKVEDLPKFLKSGDAGIVELIPTKPLCVEAFTDYAPLGRFAVRDMRQTVAVGVIKGVTKDDGSG 448          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_PIRIN (Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.975e-46
Identity = 89/136 (65.44%), Postives = 115/136 (84.56%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    K+DPA+ AA+F +QVI++NHPGQIG GYAPVLDCHT+HIA KFSEL+ KIDRR+GK +E  PKF+K+GDA +VK++P+KPM VE++++YPPLGRFAVRDMRQTVAVGVIK+VEK +  G
Sbjct:  313 KNVSVKDIRRGDVASDSKNDPAKEAASFNAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFSELIEKIDRRTGKTMEAAPKFVKSGDAAIVKLVPSKPMCVESYNEYPPLGRFAVRDMRQTVAVGVIKSVEKTEGKG 448          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_RABIT (Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.975e-46
Identity = 93/132 (70.45%), Postives = 109/132 (82.58%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            KNV ++  +RG +C   K DP + AA FTSQVII+NHPGQI  GY+PV+DCHT+HIA KF+EL  KIDRRSGK+LE  PK LK+GDA +V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKNVEKK
Sbjct:  313 KNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_HUMAN (Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.975e-46
Identity = 93/132 (70.45%), Postives = 109/132 (82.58%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            KNV ++  +RG +C   K DP + AA FTSQVII+NHPGQI  GY+PV+DCHT+HIA KF+EL  KIDRRSGK+LE  PK LK+GDA +V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKNVEKK
Sbjct:  313 KNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_BOVIN (Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.975e-46
Identity = 93/132 (70.45%), Postives = 109/132 (82.58%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            KNV ++  +RG +C   K DP + AA FTSQVII+NHPGQI  GY+PV+DCHT+HIA KF+EL  KIDRRSGK+LE  PK LK+GDA +V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKNVEKK
Sbjct:  313 KNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_SCHCO (Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.886e-46
Identity = 88/136 (64.71%), Postives = 116/136 (85.29%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    K+DPA+ AA+F +QVI++NHPGQIG GYAPVLDCHT+HIA KF+EL+ KIDRR+GK LE  PKF+K+GDA +VK++P+KPM VE++++YPPLGRFAVRDMRQTVAVG+IK+V+K D +G
Sbjct:  311 KNVSVKDIRRGNVASDSKNDPAKEAASFNAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFAELLEKIDRRTGKSLEASPKFVKSGDACIVKLVPSKPMCVESYNEYPPLGRFAVRDMRQTVAVGIIKSVDKTDKSG 446          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A2_OSCTI1.336e-4665.67Elongation factor 1-alpha 2 OS=Oscheius tipulae GN... [more]
EF1A0_XENLA1.336e-4672.31Elongation factor 1-alpha, somatic form OS=Xenopus... [more]
EF1A_CANAL1.744e-4666.18Elongation factor 1-alpha OS=Candida albicans GN=T... [more]
EF1A_CAEEL1.744e-4667.94Elongation factor 1-alpha OS=Caenorhabditis elegan... [more]
EF1A1_OSCTI2.278e-4665.67Elongation factor 1-alpha 1 OS=Oscheius tipulae GN... [more]
EF1A_PIRIN2.975e-4665.44Elongation factor 1-alpha OS=Piriformospora indica... [more]
EF1A2_RABIT2.975e-4670.45Elongation factor 1-alpha 2 OS=Oryctolagus cunicul... [more]
EF1A2_HUMAN2.975e-4670.45Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF... [more]
EF1A2_BOVIN2.975e-4670.45Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A... [more]
EF1A_SCHCO3.886e-4664.71Elongation factor 1-alpha OS=Schizophyllum commune... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top