DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_XENLA (Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.886e-46
Identity = 91/130 (70.00%), Postives = 108/130 (83.08%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K++ +G+  G     K+DP   A +FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE +PKFLK+GDA +V+MIP KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDIRRGNVAG---DSKNDPPMQAGSFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKQKIDRRSGKKLEDDPKFLKSGDAAIVEMIPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKGVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ORYLA (Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 5.075e-46
Identity = 87/119 (73.11%), Postives = 104/119 (87.39%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K+DP + AA+F +QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL+ KIDRRSGK+LE  PKF+K+GDA +VK+IP KPMVVE FS+YPPLGRFAVRDMRQTVAVGVIK V+ K+ +G
Sbjct:  330 KNDPPKAAASFNAQVIILNHPGQINQGYAPVLDCHTAHIACKFNELIEKIDRRSGKKLEDNPKFVKSGDAAIVKLIPQKPMVVEPFSNYPPLGRFAVRDMRQTVAVGVIKAVDTKEISG 448          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A3_OSCTI (Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 5.075e-46
Identity = 88/134 (65.67%), Postives = 109/134 (81.34%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K++ +GS   +C   K+DPA+ + NFT+QVI+MNHPGQI  GY PVLDCHT+HIA KF+EL  K+DRR+GK  E  PKFLK+GDAG+V++IPTKP  VE+F+DY PLGRFAVRDMRQTVAVGVIK+V K D +G
Sbjct:  319 KDIRRGS---VCSDSKNDPAKESKNFTAQVIVMNHPGQISAGYTPVLDCHTAHIACKFAELKEKVDRRTGKSTEASPKFLKSGDAGIVELIPTKPPCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVTKDDGSG 449          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_RAT (Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 5.075e-46
Identity = 93/132 (70.45%), Postives = 109/132 (82.58%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            KNV ++  +RG +C   K DP + AA FTSQVII+NHPGQI  GY+PV+DCHT+HIA KF+EL  KIDRRSGK+LE  PK LK+GDA +V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKNVEKK
Sbjct:  313 KNVSVKDIRRGNVCGDSKADPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_MOUSE (Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 5.075e-46
Identity = 93/132 (70.45%), Postives = 109/132 (82.58%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            KNV ++  +RG +C   K DP + AA FTSQVII+NHPGQI  GY+PV+DCHT+HIA KF+EL  KIDRRSGK+LE  PK LK+GDA +V+M+P KPM VE+FS YPPLGRFAVRDMRQTVAVGVIKNVEKK
Sbjct:  313 KNVSVKDIRRGNVCGDSKADPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_PICGU (Elongation factor 1-alpha OS=Pichia guilliermondii GN=TEF1 PE=3 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 8.657e-46
Identity = 88/136 (64.71%), Postives = 111/136 (81.62%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DP +   +FT+QVI++NHPGQI  GY+PVLDCHT+HIA KF  L+ KIDRR+GK++E  PKF+K+GDA +VKM+P+KPM VE F+DYPPLGRFAVRDMRQTVAVGVIK+VEK D  G
Sbjct:  311 KNVSVKEIRRGNVCGDSKNDPPKGCDSFTAQVIVLNHPGQISAGYSPVLDCHTAHIACKFDTLLEKIDRRTGKKMEDNPKFVKSGDASIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVEKSDKAG 446          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_AURPU (Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.657e-46
Identity = 87/134 (64.93%), Postives = 107/134 (79.85%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K + +G+  G     K+DP +   +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KFSELV KIDRR+GK +E  PKF+K+GDA +VKM+P+KPM VE F+DYPPLGRFAVRDMRQTVAVGVIK+V K D  G
Sbjct:  315 KEIRRGNVAG---DSKNDPPKGCDSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELVEKIDRRTGKSVEAAPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVAKSDKQG 445          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_AJECG (Elongation factor 1-alpha OS=Ajellomyces capsulata (strain ATCC 26029 / G186AR / H82 / RMSCC 2432) GN=TEF PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.657e-46
Identity = 87/133 (65.41%), Postives = 107/133 (80.45%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPT 415
            K V +G+  G     K+DP +   +F +QVI++NHPGQ+G GYAPVLDCHT+HIA KFSEL+ KIDRR+GK +E  PKF+K+GDA +VKM+P+KPM VE F+DYPPLGRFAVRDMRQTVAVGVIK+V K D T
Sbjct:  317 KEVRRGNVAG---DSKNDPPKGCESFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELIEKIDRRTGKSVENNPKFIKSGDAAIVKMVPSKPMCVEPFTDYPPLGRFAVRDMRQTVAVGVIKSVIKSDKT 446          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A4_OSCTI (Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.657e-46
Identity = 87/131 (66.41%), Postives = 109/131 (83.21%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKD 409
            K++ +GS   +C   K+DPA+ + +FT+QVI+MNHPGQIG GY PVLDCHT+HIA KF+EL  K+DRR+GK++E  PKFLK+GDAG+V++IPTKP+ VE F+DY PLGRFAVRDMRQTVAVGVIK V K D
Sbjct:  318 KDIRRGS---VCSDSKNDPAKESKSFTAQVIVMNHPGQIGAGYTPVLDCHTAHIACKFAELKEKVDRRTGKKVEDLPKFLKSGDAGIVELIPTKPLCVEAFTDYAPLGRFAVRDMRQTVAVGVIKGVTKDD 445          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A3_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-3 PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.657e-46
Identity = 92/136 (67.65%), Postives = 113/136 (83.09%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DPA+ +A+FT+QVII+NHPGQI  GYAPVLDCHT+HIA KFSEL+ KIDRRS K +E  PKF+K+GD+ +VKM+P+KPM VE ++DYPPLGRFAVRDMRQTVAVGVIK VEK D  G
Sbjct:  311 KNVSVKDIRRGNVCSDSKNDPAKESASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFSELIEKIDRRSEK-MEDSPKFVKSGDSAIVKMVPSKPMCVEAYTDYPPLGRFAVRDMRQTVAVGVIKAVEKVDKAG 445          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A2_XENLA3.886e-4670.00Elongation factor 1-alpha, oocyte form OS=Xenopus ... [more]
EF1A_ORYLA5.075e-4673.11Elongation factor 1-alpha OS=Oryzias latipes GN=ee... [more]
EF1A3_OSCTI5.075e-4665.67Elongation factor 1-alpha 3 OS=Oscheius tipulae GN... [more]
EF1A2_RAT5.075e-4670.45Elongation factor 1-alpha 2 OS=Rattus norvegicus G... [more]
EF1A2_MOUSE5.075e-4670.45Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef... [more]
EF1A_PICGU8.657e-4664.71Elongation factor 1-alpha OS=Pichia guilliermondii... [more]
EF1A_AURPU8.657e-4664.93Elongation factor 1-alpha OS=Aureobasidium pullula... [more]
EF1A_AJECG8.657e-4665.41Elongation factor 1-alpha OS=Ajellomyces capsulata... [more]
EF1A4_OSCTI8.657e-4666.41Elongation factor 1-alpha 4 OS=Oscheius tipulae GN... [more]
EF1A3_RHIRA8.657e-4667.65Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top