DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_HUMAN (Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 92/130 (70.77%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_FELCA (Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 92/130 (70.77%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_CRIGR (Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 92/130 (70.77%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_BOVIN (Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 92/130 (70.77%), Postives = 106/130 (81.54%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK 406
            K+V +G+  G     K+DP   AA FT+QVII+NHPGQI  GYAPVLDCHT+HIA KF+EL  KIDRRSGK+LE  PKFLK+GDA +V M+P KPM VE+FSDYPPLGRFAVRDMRQTVAVGVIK V+KK
Sbjct:  318 KDVRRGNVAG---DSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKK 444          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_YARLI (Elongation factor 1-alpha OS=Yarrowia lipolytica GN=TEF PE=2 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 1.929e-45
Identity = 85/134 (63.43%), Postives = 108/134 (80.60%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K++ +G+  G     K+DP +   +F +QVI++NHPGQIG GYAPVLDCHT+HIA KF  L+ KIDRR+GK++E  PKF+K+GDA +VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIK+VEK D  G
Sbjct:  317 KDIRRGNVAG---DSKNDPPKGCDSFNAQVIVLNHPGQIGAGYAPVLDCHTAHIACKFDTLIEKIDRRTGKKMEDSPKFIKSGDAAIVKMVPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKSVEKSDKAG 447          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_SORMA (Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.519e-45
Identity = 87/129 (67.44%), Postives = 108/129 (83.72%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEK 403
            K++ +G+  G     K+DP   AA+FT+QVI++NHPGQ+G GYAPVLDCHT+HIA KF+EL+ KIDRR+GK +E  PKF+K+GDA +VKMIP+KPM VE F+DYPPLGRFAVRDMRQTVAVGVIK V+K
Sbjct:  317 KDIRRGNVAG---DSKNDPPVGAASFTAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLEKIDRRTGKAVETSPKFIKSGDAAIVKMIPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKAVDK 442          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_PUCGR (Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 2.519e-45
Identity = 90/133 (67.67%), Postives = 109/133 (81.95%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKD 409
            KNV ++  +RG +C   K DP + AA+F +QVI++NHPGQIGNGY PVLDCHT+HIA KF  L  KIDRR+GK LE+ PKF+K+GDA +VKM+P+K M VE F+DYPPLGRFAVRDMRQTVAVGVIK+VEK D
Sbjct:  310 KNVSVKDIRRGNVCGDTKCDPPKEAASFVAQVIVLNHPGQIGNGYCPVLDCHTAHIACKFDTLQQKIDRRTGKALEEAPKFVKSGDACLVKMVPSKAMCVEPFADYPPLGRFAVRDMRQTVAVGVIKSVEKTD 442          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_PODAN (Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.519e-45
Identity = 86/129 (66.67%), Postives = 107/129 (82.95%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEK 403
            K + +G+  G     K+DP   AA+F +QVI++NHPGQ+G GYAPVLDCHT+HIA KFSEL+ KIDRR+GK +E+ PKF+K+GDA +VKM+P+KPM VE F++YPPLGRFAVRDMRQTVAVGVIK VEK
Sbjct:  317 KEIRRGNVAG---DSKNDPPMGAASFDAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFSELLQKIDRRTGKAVEESPKFIKSGDAAIVKMVPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKKVEK 442          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ONCVO (Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.519e-45
Identity = 87/134 (64.93%), Postives = 108/134 (80.60%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K++ +GS   +    K+DPA+    FT+QVIIMNHPGQI  GY PVLDCHT+HIA KF+EL  K+DRRSGK++E  PK LK+GDAG++ +IPTKP+ VETF++YPPLGRFAVRDMRQTVAVGVIKNV+K +  G
Sbjct:  318 KDIRRGS---VASDSKNDPAKETKMFTAQVIIMNHPGQISAGYTPVLDCHTAHIACKFAELKEKVDRRSGKKVEDNPKSLKSGDAGIIDLIPTKPLCVETFTEYPPLGRFAVRDMRQTVAVGVIKNVDKSEGVG 448          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ASPOR (Elongation factor 1-alpha OS=Aspergillus oryzae GN=tef1 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.519e-45
Identity = 86/129 (66.67%), Postives = 108/129 (83.72%), Query Frame = 2
Query:   17 KNVLQGSQRGLCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEK 403
            K V +G+  G     K+DP     +F +QVI++NHPGQ+GNGYAPVLDCHT+HIA KF+EL+ KIDRR+GK +E +PKF+K+GDA +VKMIP+KPM VE+F+D+PPLGRFAVRDMRQTVAVGVIK+VEK
Sbjct:  317 KEVRRGNVAG---DSKNDPPAGCDSFNAQVIVLNHPGQVGNGYAPVLDCHTAHIACKFAELLEKIDRRTGKSVEDKPKFIKSGDAAIVKMIPSKPMCVESFTDFPPLGRFAVRDMRQTVAVGVIKSVEK 442          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A1_HUMAN1.477e-4570.77Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF... [more]
EF1A1_FELCA1.477e-4570.77Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1... [more]
EF1A1_CRIGR1.477e-4570.77Elongation factor 1-alpha 1 OS=Cricetulus griseus ... [more]
EF1A1_BOVIN1.477e-4570.77Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A... [more]
EF1A_YARLI1.929e-4563.43Elongation factor 1-alpha OS=Yarrowia lipolytica G... [more]
EF1A_SORMA2.519e-4567.44Elongation factor 1-alpha OS=Sordaria macrospora G... [more]
EF1A_PUCGR2.519e-4567.67Elongation factor 1-alpha OS=Puccinia graminis GN=... [more]
EF1A_PODAN2.519e-4566.67Elongation factor 1-alpha OS=Podospora anserina GN... [more]
EF1A_ONCVO2.519e-4564.93Elongation factor 1-alpha OS=Onchocerca volvulus P... [more]
EF1A_ASPOR2.519e-4566.67Elongation factor 1-alpha OS=Aspergillus oryzae GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top