DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ASHGO (Elongation factor 1-alpha OS=Ashbya gossypii GN=TEF PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.785e-44
Identity = 88/136 (64.71%), Postives = 107/136 (78.68%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +C   K+DP + A +F + VI++NHPGQI  GY+PVLDCHT+HIA KF EL+ K DRR+GK+LE  PKFLK GDA MVK +P+KPM VE F+DYPPLGRFAVRDMRQTVAVGVIK+V K D  G
Sbjct:  311 KNVSVKEIRRGNVCGDSKNDPPKAAESFNATVIVLNHPGQISAGYSPVLDCHTAHIACKFDELLEKNDRRTGKKLEDSPKFLKAGDAAMVKFVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVVKSDKAG 446          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ARTSA (Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 8.103e-44
Identity = 80/118 (67.80%), Postives = 100/118 (84.75%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPT 415
            K++PAR + +F +QVI++NHPGQI NGY PVLDCHT+HIA KF+E+  K DRR+GK  E EPKF+K+GDA M+ ++P+KP+ VE FSD+PPLGRFAVRDMRQTVAVGVIK+V  KDPT
Sbjct:  330 KNNPARGSQDFFAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEAEPKFIKSGDAAMITLVPSKPLCVEAFSDFPPLGRFAVRDMRQTVAVGVIKSVNFKDPT 447          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_YEAST (Elongation factor 1-alpha OS=Saccharomyces cerevisiae GN=TEF1 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.382e-43
Identity = 85/133 (63.91%), Postives = 108/133 (81.20%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKD 409
            KNV ++  +RG +C   K+DP +  A+F + VI++NHPGQI  GY+PVLDCHT+HIA +F EL+ K DRRSGK+LE  PKFLK+GDA +VK +P+KPM VE FS+YPPLGRFAVRDMRQTVAVGVIK+V+K +
Sbjct:  311 KNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTE 443          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_TETPY (Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.170e-42
Identity = 82/116 (70.69%), Postives = 95/116 (81.90%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKD 409
            K+DPA+ AA F SQVIIMNHPGQI  GY PVLDCHT+HIA KF  +  KIDRR+GK  E+ PKF+KNGDA +V +IPTK + VE F +YPPLGR+AVRDM+QTVAVGVIK VEKKD
Sbjct:  319 KNDPAKEAATFYSQVIIMNHPGQIQAGYTPVLDCHTAHIACKFETIHDKIDRRTGKSQEENPKFIKNGDAALVTLIPTKALCVEVFQEYPPLGRYAVRDMKQTVAVGVIKKVEKKD 434          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_EIMBO (Elongation factor 1-alpha (Fragment) OS=Eimeria bovis PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.528e-42
Identity = 84/136 (61.76%), Postives = 110/136 (80.88%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    K+DPA+ AA+F +QVI+++HPGQI  GY+PV+DCHT+HIA KF+ L  ++DRRSGK LE +PKF+K GDA ++KM P+KPM VE+F +YPPLGRFAVRDM+QTVAVGVIK VEKK+  G
Sbjct:  198 KNVSVKDVKRGHVASDSKNDPAKAAASFQAQVIVLHHPGQINPGYSPVVDCHTAHIACKFAVLEKRLDRRSGKALEDDPKFIKTGDAAIIKMEPSKPMCVESFIEYPPLGRFAVRDMKQTVAVGVIKGVEKKEAGG 333          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A1_DROME (Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 1.528e-42
Identity = 78/119 (65.55%), Postives = 99/119 (83.19%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K +P + AA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KF+E+  K+DRRSGK  E+ PKF+K+GDA +V ++P+KP+ VE F ++PPLGRFAVRDMRQTVAVGVIK V  KD +G
Sbjct:  330 KANPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRRSGKTTEENPKFIKSGDAAIVNLVPSKPLCVEAFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKDASG 448          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_HYDAT (Elongation factor 1-alpha OS=Hydra attenuata PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.294e-41
Identity = 85/131 (64.89%), Postives = 106/131 (80.92%), Query Frame = 2
Query:   17 KNV-LQGSQRGL-CXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEK 403
            KNV ++  +RG+     K+DPA  AA+F +QVII+NHPG+I  GY PVLDCHT+HIA KF+EL+ KIDRRSGK +E EPK +K+GDA ++ +IP+K M VE+FS YPPLGRFAVRDMRQTVAVGVIK V+K
Sbjct:  315 KNVSIKDIRRGMVASDSKNDPAIEAASFKAQVIILNHPGEIHAGYQPVLDCHTAHIACKFAELLEKIDRRSGKVIETEPKMVKSGDAAIINLIPSKGMCVESFSQYPPLGRFAVRDMRQTVAVGVIKEVDK 445          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_DROME (Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=1 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.294e-41
Identity = 77/118 (65.25%), Postives = 99/118 (83.90%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPT 415
            K++P R AA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KFSE+  K DRR+GK  E EPK +K+GDA ++ ++P+KP+ VE+F ++PPLGRFAVRDMRQTVAVGVIK+V  K+ T
Sbjct:  330 KNNPPRGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFSEIKEKCDRRTGKTTETEPKAIKSGDAAIIVLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVNFKETT 447          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_APIME (Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.207e-41
Identity = 79/119 (66.39%), Postives = 96/119 (80.67%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            K+ P R AA+FT+QVI++NHPGQI NGY PVLDCHT+HIA KF+E+  K DRR+GK  E+ PK +K+GDA +V + PTKPM VE F ++PPLGRFAVRDMRQTVAVGVIK+V  KD  G
Sbjct:  330 KNQPPRGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKSIKSGDAAIVMLQPTKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKSVTFKDTQG 448          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_CRYPV (Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.882e-41
Identity = 80/135 (59.26%), Postives = 107/135 (79.26%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPT 415
            KNV ++  +RG +    K+DPA+   +FT+QVI++NHPG+I NGY+PV+DCHT+HI+ KF  +  K+D+RSGK LE+ PK +K+GDA +V M P KP+ VE F+DYPPLGRFAVRDM+QTVAVGVIK+V KK+ T
Sbjct:  297 KNVSIKDIKRGFVASDAKNDPAKGCEDFTAQVIVLNHPGEIKNGYSPVVDCHTAHISCKFQTITAKMDKRSGKVLEENPKLIKSGDAALVVMQPLKPLCVEAFTDYPPLGRFAVRDMKQTVAVGVIKSVTKKEAT 431          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A_ASHGO2.785e-4464.71Elongation factor 1-alpha OS=Ashbya gossypii GN=TE... [more]
EF1A_ARTSA8.103e-4467.80Elongation factor 1-alpha OS=Artemia salina PE=1 S... [more]
EF1A_YEAST1.382e-4363.91Elongation factor 1-alpha OS=Saccharomyces cerevis... [more]
EF1A_TETPY1.170e-4270.69Elongation factor 1-alpha OS=Tetrahymena pyriformi... [more]
EF1A_EIMBO1.528e-4261.76Elongation factor 1-alpha (Fragment) OS=Eimeria bo... [more]
EF1A1_DROME1.528e-4265.55Elongation factor 1-alpha 1 OS=Drosophila melanoga... [more]
EF1A_HYDAT1.294e-4164.89Elongation factor 1-alpha OS=Hydra attenuata PE=2 ... [more]
EF1A2_DROME1.294e-4165.25Elongation factor 1-alpha 2 OS=Drosophila melanoga... [more]
EF1A_APIME2.207e-4166.39Elongation factor 1-alpha OS=Apis mellifera PE=3 S... [more]
EF1A_CRYPV2.882e-4159.26Elongation factor 1-alpha OS=Cryptosporidium parvu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top